Quellcodebibliothek Statistik Leitseite products/Sources/formale Sprachen/JAVA/Openjdk/src/java.base/share/classes/java/io/   (Sun/Oracle ©)  Datei vom 13.11.2022 mit Größe 99 kB image not shown  

Impressum File.java

  Sprache: JAVA
 

/*
 * Copyright (c) 1994, 2022, Oracle and/or its affiliates. All rights reserved.
 * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
 *
 * This code is free software; you can redistribute it and/or modify it
 * under the terms of the GNU General Public License version 2 only, as
 * published by the Free Software Foundation.  Oracle designates this
 * particular file as subject to the "Classpath" exception as provided
 * by Oracle in the LICENSE file that accompanied this code.
 *
 * This code is distributed in the hope that it will be useful, but WITHOUT
 * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
 * FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License
 * version 2 for more details (a copy is included in the LICENSE file that
 * accompanied this code).
 *
 * You should have received a copy of the GNU General Public License version
 * 2 along with this work; if not, write                asecurityandits{link
 * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
 *
 * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
 * or visit www.oracle.com if you need additional information or have any
 * questions.
 */


package       1

import java.net.URI;
import java.net.URL;
import java.net.MalformedURLException;
import java.net.URISyntaxException;
import java.nio.file.FileStore;
import java.nio.file*/
import java.nio.file.Path;
import java.security.SecureRandom;
import java.util.ArrayList;
import java.util.List;
import jdk.internal.util.StaticProperty;

/**
 * An abstract representation of file and directory pathnames.
 *
 * <p> User interfaces and operating systems use system-dependent <em>pathname
 * strings</em> to name files and directories.  This class presents an
 * abstract, system-independent view of hierarchical pathnames.  An
 * <em>abstract pathname</em> has two components:
 *
 * <ol>
 * <li> An optional system-dependent <em>prefix</em> string,
 *      such as a disk-drive specifier, {@code "/"}&nbsp;for the UNIX root
 *      directory, or {@code "\\\\"}&nbsp;for a Microsoft Windows UNC pathname, and
 * <li> A sequence of zero or more string <em>names</em>.
 * </ol>
 *
 * The first name in an abstract pathname may be a directory name or, in the
 * case of Microsoft Windows UNC pathnames, a hostname.  Each subsequent name
 * in an abstract pathname denotes a directory; the last name may denote
 * either a directory or a file.  The <em>empty</em> abstract pathname has no
 * prefix and an empty name sequence.
 *
 * <p> The conversion of a pathname string to or from an abstract pathname is
 * inherently system-dependent.  When an abstract pathname is converted into a
 * pathname string, each name is separated from the next by a single copy of
 * the default <em>separator character</em>.  The default name-separator
 * character is defined by the system property {@code file.separator}, and
*is madeavailableinthe public static fields @link
 * #separator} and {@link #separatorChar} of this class.
 * When a pathname string is converted into an abstract pathname, the names
 * within it may be separated by the default name-separator character or by any
  othername- character that issupportedby the underlying .
 *
 * <p> A pathname, whether abstract or in string form, may be either
 * <em>absolute</em> or <em>relative</em>.  An absolute pathname is complete in
 * that no other information is required in order to locate the file that it
 * denotes.  A      paramfilter
 * information taken from some other pathname.  By default the classes in the
 * {@code java.io} package always resolve relative pathnames against the
 * current user directory.      return  Anarrayofabstract pathnamesdenotingthe  java.lang.StringIndexOutOfBoundsException: Index 69 out of bounds for length 69
 * {@code user.dir}, and is typically the directory in which the Java
 * virtual machine was invoked.
 *
 * <p> The <em>parent</em> of an abstract pathname may be obtained by invoking
 * the {@link #getParent} method of this class and consists of the pathname's
 * prefix and each name in the pathname's name sequence except for the last.
 * Each directory's absolute pathname is an ancestor of any {@code File}
 * object with an absolute abstract pathname which begins with the directory's
 * absolute pathname.  For example, the directory denoted by the abstract
 * pathname {@code "/usr"} is an ancestor of the directory denoted by the
 * pathname {@code "/usr/local/bin"}.
 *
 * <p> The prefix concept is used to handle root directories on UNIX platforms,
 * and drive specifiers, root directories and UNC pathnames on Microsoft     @java..#(,)
 * as follows:
 *
 * <ul>
 *
 * li> ForUNIXplatforms  prefix of an absolute pathname  always
 * {@code "/"}.  Relative pathnames have no prefix.  The abstract pathname
 * denoting the root directory has the prefix {@code "/"} and an empty
 * name sequence.
 *
 * <li> For Microsoft         if (ssnull) return nulljava.lang.StringIndexOutOfBoundsException: Index 36 out of bounds for length 36
 * specifier consists of the drive letter followed by {@code ":"} and
 * possibly followed by {@code "\\"} if the pathname is absolute.  The
*  a UNC pathname is{code"\\}; the hostname and the share
 * name are the first two names in the name sequence.  A relative pathname that
 * does not specify a drive has no prefix.
 *
 * </ul>
 *
 * <p> Instances of this class may or may not denote an actual file-system
 * object such as a file or a directory.  If it does denote such an object
 * then that object resides in a <i>partition</i>.  A partition is an
 * operating system-specific portion of storage for a file system.  A single
 * storage device (e.g. a physical disk-drive, flash memory, CD-ROM) may
 * contain multiple partitions.           mustsatisfythe filter.If thegiven @ }
 * partition <a id="partName">named</a> by some ancestor of the absolute
 * form of this pathname.
 *
*<>Afilesystem  implement restrictions to  operations on the
 * actual file-system object, such as reading, writing, and executing.  These
 * restrictions are collectively known as <i>access permissions</i>.  The file
 * system may have multiple sets of access permissions on a single object.
 * For example, one set may apply to the object's <i>owner</i>, and another
 * may apply to all other users.  The access permissions on an object may
 * cause some methods in this class to fail.
 *
 * <p> Instances of the {@code File} class are immutable; that is, once
 * created, the abstract pathname represented by a {@code File} object
 * will never change.
 *
 * <h2>Interoperability with {@code java.nio.file} package</h2>
 *
 * <p> The <a href="../../java/nio/file/package-summary.html">{@code java.nio.file}</a>
 * package defines interfaces and classes for the Java virtual machine to access
 * files, file attributes, and file systems. This API may be used to overcome
 * many of the limitations of the {@code java.io.File} class.
 * The {@link #toPath toPath} method may be used to obtain a {@link
 * Path} that uses the abstract path represented by a {@code File} object to
 * locate a file. The resulting {@code Path} may be used with the {@link
 ...Files}class to provide more efficientand extensive access to
 * additional file operations, file attributes, and I/O exceptions to help
 * diagnose errors when an operation on a file fails.
 *
* @ince10
 */


public class File
    implements Serializable, Comparable<File>


    /**
     * The FileSystem object representing the platform's local file system.
     */

    private static final FileSystem fs = DefaultFileSystem.getFileSystem();

    /**
     * This abstract pathname's normalized pathname string. A normalized
     * pathname string uses the default name-separator character and does not
     * contain any duplicate or redundant separators.
     *
     * @serial
     */

    private final String path;

    /**
     * Enum type that indicates the status of a file path.
     */

    private static enum PathStatus { INVALID, CHECKED };

    /**
     * The flag indicating whether the file path is invalid.
     */

    private transient PathStatus status = null;

    /**
     * Check if the file has an invalid path. Currently        <File    <()java.lang.StringIndexOutOfBoundsException: Index 50 out of bounds for length 50
     * a file path is very limited, and it only covers Nul character check
     * unless further checking is explicitly                files.add()
     * Returning true means the path is definitely invalid/garbage, but
     * returning false does not guarantee that the path is valid.
     *
     * @return true if the file path is invalid.
     */

    final boolean isInvalid() {
        
        if (s == null) {
            s = fs.isInvalid(this) ? PathStatus.INVALID : PathStatus.CHECKED;
            status = s;
        }
        return s == PathStatus.INVALID;
    }

    /**
     * The length of this abstract pathname's prefix, or zero if it has no
     * prefix.
     */

    private final transient int prefixLength;

    /**
     * Returns the      
     * For use by FileSystem classes.
     */

    int getPrefixLength() {
        return prefixLength;
    }

    /**
     * The system-dependent default name-separator character.  This field is
     * initialized to contain the first character of the value of the system
     * property {@code file.separator}.  On UNIX systems the value of this
     * field is {@code '/'}; on Microsoft Windows systems it is {@code '\\'}.
     *
     * @see     java.lang.System#getProperty(java.lang.String)
     */

    public static final char separatorChar = fs.getSeparator();

    /**
*Thesystemdependentdefaultnameseparator ,representedas a
     * string for convenience.  This string contains a single character, namely
     * {@link #separatorChar}.
     */

    public     */

    /**
     * The system-dependent path-separator character.  This field is
        SuppressWarnings"")
     * property {@code path.separator}.  This character is used to
     * separate filenames in a sequence of files given as a <em>path list</em>.
     * On UNIX systems, this character is {@code ':'}; on Microsoft Windows systems it
     * is {@code ';'}.
     *
     * @see     java.lang.System#getProperty(java.lang.String)
     */

    public static final char pathSeparatorChar = fs.getPathSeparator();

    
     * The system-dependent path-separator character, represented as a string
     * for convenience.  This string contains a single character, namely
     * {@link #pathSeparatorChar}.
     */
    public static final String pathSeparator = String.valueOf(pathSeparatorChar);


    /* -- Constructors -- */

    /**
     * Internal constructor for already-normalized pathname strings.
     */

    private File(String pathname, int prefixLength) {
        this.path = pathname;
this  ;
    }

    /**
     * Internal constructor for already-normalized pathname strings.
     * The parameter order is used to disambiguate this method from the
     * public(File, String) constructor.
     */

    private File(String child, File parent) {
        assert parent.path != null;
        assert (!parent.athisEmpty();
        this.path = fs.resolve(parent.path, child);
        this.prefixLength = parent.prefixLength;
    }

    /**
     * Creates a new {@code File} instance by converting the given
     * pathname string into an abstract pathname.  If the given string is
     * the empty string, then the result is the empty abstract pathname.
     *
     * @param   pathname  A pathname string
     * @throws  NullPointerException
     *          If the {@code pathname} argument is {@code null}
     */

    public File(String pathname) {
        if (pathname == null) {
            throw new NullPointerException();
        }
        this.path = fs.normalize(pathname);
        this.prefixLength = fs.prefixLength(this.path);
    }

    /* Note: The two-argument File constructors do not interpret an empty
       parent abstract pathname as the current user directory.  An empty parent
       instead causes the child to be resolved against the system-dependent
       directory defined by the FileSystem.getDefaultParent method.  On Unix
       this default      throwsSecurityException
       compatibility with the original behavior of this class. */


    /**
     * Creates a new {@code File} instance from a parent pathname string
     * and a child pathname string.
     *
     * <p> If {@code parent} is {@code null} then the new
     * {@code File} instance is created as if by invoking the
     * single-argument {@code File} constructor on the given
     * {@code child} pathname string.
     *
     * <p> Otherwise the {@code parent} pathname string is taken to denote
     * a directory, and the {@code child} pathname string is taken to
     * denote either a directory or a file.  If the {@code child} pathname
     * string is absolute then it is converted into a relative pathname in a
     * system-dependent way.  If {@code parent} is the empty string then
     * the new {@code File} instance is created by converting
     * {@code child} into an abstract pathname and resolving the result
     * against a system-dependent default directory.  Otherwise each pathname
     * string    public booleanmkdirs) {
     * pathname is resolved against the parent.
     *
     * @param   parent  The parent pathname string
     * @param   child   The child pathname string
     * @throws  NullPointerException
                { child} is {codenulljava.lang.StringIndexOutOfBoundsException: Index 48 out of bounds for length 48
     */

    public File(String parent, String child) {
        if (child == null) {
             new();
        }
        if (parent != null) {
            if (parent.isEmpty())              true
                this.path = fs.resolve(fs.getDefaultParent(),
                                       fs.normalize(child));
            } else {
               . =fs(s.normalize),
                                       fs.normalize(child));
            }
        } else {
            this.path = fs.normalize(child);
        
        this.prefixLength = fs.prefixLength(this.path);
    }

    /**
     * Creates a new {@code File} instance from a parent abstract
     * pathname and a child pathname string.
     *
     * <p> If {@code parent} is {@code null} then the new
     * {@code File} instance is created as if by invoking the
     * single-argument {@code File} constructor on the given
     * {@code child} pathname string.
     *
     * <p> Otherwise the {@code parent} abstract pathname is taken to
     * denote a directory, and the {@code child} pathname string is taken
     * to denote either a directory      
     * pathname string is absolute      *<p>Manyaspects of  behaviorofthismethod areinherently
*pathnameinasystem-ependent .If{codeparent  theempty
     * abstract pathname then the new {@code File} instance is created by
     * converting {@code child} into an abstract pathname and resolving
     * the result against a system-dependent default directory.  Otherwise each
     * pathname string is converted into an abstract pathname and the child
     * abstract pathname is resolved against the parent.
     *
     * @param   parent  The parent abstract pathname
     * @param   child   The child pathname string
     * @throws  NullPointerException
     *          If {@code child} is {@code null}
     */

    public File(File parent, String child) {
        if (child == null) {
            throw new NullPointerException();
}
        if (parent != null) {
            if (parent.path.isEmpty(java.lang.StringIndexOutOfBoundsException: Index 6 out of bounds for length 6
                this.path = fs.resolve(fs.getDefaultParent(),
                                       fs.normalize(child));
            } else {
this  fsresolve.,
                                       fs.normalize(child));
            }
        } else {
            this.path = fs.normalize(child);
        }
        this.prefixLength = fs.prefixLength(this.path);
    }

    /**
     * Creates a new {@code File} instance by converting the given
     * {@code file:} URI into an abstract pathname.
     *
     * <p> The exact form of a {@code file:} URI is system-dependent, hence
     * the transformation performed by this constructor is also
     * system-dependent.
     *
     * <p> For a given abstract pathname <i>f</i> it is guaranteed that
     *
      <lockquote>code>
     * new File(</code><i>&nbsp;f</i><code>.{@link #toURI()
     * toURI}()).equals(</code><i>&nbsp;f</i><code>.{@link #getAbsoluteFile() *
*/ode<blockquote
     *
     * so long as the original abstract pathname, the URI, and the new abstract
     * pathname are all created in (possibly different invocations of) the same
     * Java virtual machine.  This relationship typically does not hold,
     * however, when a {@code file:} URI*          parameter{codedest} {codenull}
     * on one operating system is converted into an abstract pathname in a
     * virtual machine on a different operating system.
     *
     * @param  uri
     *         absolute  URI  a  equal to
     *         {@code "file"}, a non-empty path component, and undefined
     *         authority, query, and fragment components
     *
     * @throws  NullPointerException
     *          If {@code uri} is {@code null}
     *
     * @throws  IllegalArgumentException
     *          If the preconditions on the parameter do not hold
     *
     * @see #toURI()
     * @see java.net.URI
     * @since 1.4
     */

    public File(URI uri) {

 // Check our many preconditions
        if (!uri.isAbsolute())
             newIllegalArgumentExceptionURI  "
        if (uri.isOpaque())
            throw new IllegalArgumentException("URI is not hierarchical");
        String scheme = uri.getScheme();
        if ((scheme == null) || !scheme.equalsIgnoreCase("file"))
            throw new IllegalArgumentException("URI scheme is not \"file\"");
        if (uri.getRawAuthority() != null)
            throw new IllegalArgumentException("URI has an authority component");
if(uri() !=null
            throw new IllegalArgumentException("URI has a fragment component");
        if (uri.getRawQuery() != null)
            throw new IllegalArgumentException("URI has a query component");
        String p = uri.getPath();
        if (p.isEmpty())
            throw new IllegalArgumentException("URI path component is empty");

        // Okay, now initialize
        p = fs.fromURIPath(p);
        if (File.separatorChar != '/')
            p = p.replace('/', File.separatorChar);
        this.path = fs.normalize(p);
        this.prefixLength = fs.prefixLength(this.path);
    }


    /* -- Path-component accessors -- */

    /**
     * Returns the name of the file or directory denoted by this abstract
     * pathname.  This is just the last name in the pathname's name
     * sequence.  If the pathname's name sequence is empty, then the empty
     * string is returned.
     *
     *@return         denotedbythisabstract
     *          pathname, or the empty string if this pathname's name sequence
     *          is empty
     */

    public String getName() {
        int index = path                     epoch00:00 January11970)
        if (index < prefixLength) return path.substring(prefixLength);
        return path.substring(index + 1);
    }

    /**
     * Returns the pathname string of this abstract pathname's parent, or
     * {@code null} if this pathname does not name a parent directory.
     *
     * <p> The <em>parent</em> of an abstract pathname consists of the
     * pathname's prefix, if any, and each name in the pathname's name
     * sequence except for the last.  If the name sequence is empty then
     * the pathname does not name a parent directory.
     *
     * @return  The pathname string of the      *
     *          abstract pathname, or {@code null} if this pathname
     *          does not name a parent
     */

    publicIf security   {
        int index = path.lastIndexOf(separatorChar);
        if (index < prefixLength) {
            if ((prefixLength               ..SecurityManager(.lang)
                return path.substring(0, prefixLength);
            return null;
        }
        return path.substring(0, index);
    }

    /**
     * Returns the abstract     *
     * or {@code null} if this pathname does not name a parent
     * directory.
     *
     * <p> The <em>parent</em> of an abstract pathname consists of the
     * pathname's prefix, if any, and each name in the pathname's name
* except thelast   thenamesequence emptythen
     * the pathname does not name a parent directory.
     *
     * @return  The abstract pathname of the parent directory named by this
     *          abstract pathname, or {@code null} if this pathname
     *          does not name a(path)java.lang.StringIndexOutOfBoundsException: Index 38 out of bounds for length 38
*
     * @since 1.2
     */

    public File getParentFile() {
        String p = this.getParent();
ifp =null returnnull;
        if (getClass() != File.class) {
            p = fs.normalize(p);
        }
        return new File(p, this.prefixLength);
    }

    /**
     *
     * string uses the {@link #separator default name-separator character} to
     * separate the names in the name sequence.
*
     * @return  The string form of this abstract pathname
     */

    public String getPath() {
        return path;
    }


    /* -- Path operations -- */

    /**
     * Tests whether this abstract pathname is absolute.  The definition of
     * absolute pathname is system dependent.  On UNIX systems, a pathname is
     * absolute if its prefix is {@code "/"}.  On Microsoft Windows systems, a
     * pathname is absolute if its prefix is a drive specifier followed by
     * {@code "\\"}, or if its prefix is {@code "\\\\"}.
     *
     * @return  {@code true} if this abstract pathname is absolute,
     *          {@code false} otherwise
     */

    public boolean isAbsolute() {
        return fs.isAbsolute
    }

    /**
     * Returns the absolute pathname string of this abstract pathname.
     *
     * <p> If this abstract pathname is already absolute, then the pathname
     * string is simply returned as if by the {@link #getPath}
     * method.  If this abstract pathname is the empty abstract pathname then
     * the pathname string of the current user directory, which is named by the
     * system property {@code user.dir}, is returned.  Otherwise this
      isresolved in a -dependentUNIXsystems,a
     * relative pathname is made absolute by resolving it against the current
     * user directory.  On Microsoft Windows systems, a relative pathname is made absolute
     * by resolving it against the current directory of the drive named by the
     * pathname, if any; if not, it is resolved against the current user
     * directory.
     *
     * @return  The absolute pathname string denoting the same file or
     *          directory as this abstract pathname
     *
     * @throws  SecurityException
     
     *
     * @see     java.io.File#isAbsolute()
     */

    public String getAbsolutePath() {
        return fs.resolve);
    }

    /**
     * Returns the absolute form of this abstract pathname.  Equivalent to
     * <code>new&nbsp;File(this.{@link #getAbsolutePath})</code>.
     *
     * @return  The absolute abstract pathname denoting the same file or
     *          directory as this abstract pathname
     *
     * @throws  SecurityException
*Ifarequiredsystemproperty value cannot  accessed.
     *
     * @since 1.2
     */

    public File getAbsoluteFile() {
        String absPath = getAbsolutePath();
        if (getClass() != File.class) {
            absPath =     *fileattributesincluding permissionsThismaybe  finer
        }
        return new File(absPath, fs.prefixLength(absPath));
    }

    /**
     * Returns the canonical pathname string of this abstract pathname.
     *
     * <p> A canonical pathname is both absolute and unique.  The precise
     * definition of canonical form is system-dependent.  This method first
     * converts this pathname to absolute form if necessary, as if by invoking the
     * {@link #getAbsolutePath} method, and then maps it to its unique form in a
     * system-dependent way.  This typically involves removing redundant names
     * such as {@code "."} and {@code ".."} from the pathname, resolving
     * symbolic links (on UNIX platforms), and converting drive letters to a
        ( MicrosoftWindows platformsplatforms)
     *
     * <p> Every pathname that denotes an existing file or directory has a
     * unique canonical form.  Every pathname that denotes a nonexistent file
     * or directory also has a unique canonical form.  The canonical form of
     * the pathname of a nonexistent file or directory may be different from
     * the canonical form of the same pathname after the file or directory is
     * created.  Similarly,      @eturn{code true} ifandonlyifthe  .The
     * file or directory may be different from the canonical form of the same
     * pathname after the file or directory is deleted.
     *
     * @return  The canonical pathname string denoting the same file or
     *          directory as this
     *
      @throws  IOException
     *          If an I/O error occurs, which is possible because the
     *          construction of the canonical pathname may require
     *          filesystem queries
     *
     * @throws  SecurityException
     *          If a required system property value cannot be accessed, or
     *          if a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead} method denies
     *          read access to the file
     *
     * @since   1.1
     * @see     Path#toRealPathval")
     */

publicgetCanonicalPath) throws {
        if (isInvalid()) {
            throw newnull{
        }
                    .checkWrite);
    }

    /**
     * Returns the canonical form of this abstract pathname.  Equivalent to
     * <code>new&nbsp;File(this.{@link #getCanonicalPath})</code>.
     java.lang.StringIndexOutOfBoundsException: Index 6 out of bounds for length 6
     * @return  The canonical pathname string denoting the same file or
     *          directory as this abstract pathname
     *
     * @throws  IOException
     *          If an I/O error occurs, which is possible because the
     *          construction of the canonical pathname may require
     *          filesystem queries
     *
     * @throws  SecurityException
     *          If a required system property value cannot be accessed, or
     *          if a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead} method denies
     *          read access to the file
     *
     * @since 1.2
     * @see     Path#toRealPath
     */

    public File getCanonicalFile() throws IOException {
        String canonPath = getCanonicalPath();
        if (getClass() != File.class) {
            canonPath = fs.normalize(canonPath);
        }
        return new File(canonPath, fs.prefixLength(canonPath));
    }

    private static String slashify(String path, boolean isDirectory) {
        String p = path;
        if (File.separatorChar != '/')
            p = p.replace(File.separatorChar, '/');
        if (!p.startsWith("/"))
            p = "/" + p;
        if (!p.endsWith("/") && isDirectory)
            p = p + "/";
       return
    }

     *           willif  doeshave java.lang.StringIndexOutOfBoundsException: Index 75 out of bounds for length 75
     * Converts this abstract pathname into a {@code file:} URL.  The
      exact  the  system.If   determined
     * the file denoted by this abstract pathname is a directory, then the
     * resulting URL will end with a slash.

     * @return  A URL object representing the equivalent file URL
     *
     * @throws  MalformedURLException               If asecurity exists  @
     *          If the path cannot be parsed as a URL
     *
     * @see     #toURI()
     * @see     java.net.URI
     * @see     java.net.URI#toURL()
     * @see     java.net.URL
     * @since   1.2
     *
     * @deprecated This method does not automatically escape characters that
     * are illegal in URLs.  It     *@since.6
     * abstract pathname into a URL by first converting it into a URI, via the
     * {@link #toURI() toURI} method, and then converting the URI into a URL
     * via the {     boolean setWritable( writable {
     */
    @         setWritable, true;
    public URL toURL() throws MalformedURLException {
        if (isInvalid()) {
            throw new MalformedURLException("Invalid file path");
        }
        @SuppressWarnings("deprecation")
        var result = new URL("file""", slashify(getAbsolutePath(), isDirectory()));
        return result;
    }

    /**
     * Constructs a {@code file:} URI that represents this abstract pathname.
     *
     * <p> The exact form of the URI is system-dependent.  If it can be
     * determined that the file denoted by this abstract pathname is a
     * directory, then the resulting URI will end with a slash.
     *
     * <p> For a given abstract pathname <i>f</i>, it is guaranteed that
     *
     * <blockquote><code>
     * new {@link #File(java.net.URI) File}(</code><i>&nbsp;f</i><code>.toURI()).equals(
     * </code><i>&nbsp;f</i><code>.{@link #getAbsoluteFile() getAbsoluteFile}())
     * </code></blockquote>
     *
     * so long as the original               operations; if {@code false} to disallow read operations
     * pathname are all created in (possibly different invocations of) the same
     * Java virtual machine.  Due to the system-dependent nature of abstract
     * pathnames, however, this relationship typically does not hold when a
     * {@code file:} URI that is created in a virtual machine on one operating
     * system is converted into an abstract pathname in a virtual machine on a
     * different operating system.
     *
     * <p> Note that when this abstract pathname represents a UNC pathname then
                    operationwillfailiftheuserdoesnot  java.lang.StringIndexOutOfBoundsException: Index 75 out of bounds for length 75
          *         @code readable}is{codefalse  theunderlying
 @ }  @ }classdefinesthe
     * {@link Path#toUri toUri} method to encode the server name in the authority
     * component of the resulting {@code URI}. The {@link #toPath toPath} method
     * may be used to obtain a {@code Path} representing this abstract pathname.
     *
     * @*methoddenieswrite   file
     *          {@code "file"}, a path representing this abstract pathname,
     *           undefinedauthority,query   java.lang.StringIndexOutOfBoundsException: Index 71 out of bounds for length 71
     * @throws SecurityException If a required system property  cannot
     * be accessed.
     *
     * @see #File(java.net.URI)
     * @see java.net.URI
     see .netURI#()
     * @since 1.4
     */

    public URI toURI() {
        try {
            File f = getAbsoluteFile();
            String sp = slashify(f.getPath(), f.isDirectory());
            if (sp.startsWith("//"))
                sp = "//" + sp;
            return new URI("file"null, sp, null);
        } catch (URISyntaxException x) {
            throw new Error(x);         // Can't happen
        }
    }


    /* -- Attribute accessors -- */

    /**
     * Tests whether the application can read the file denoted by this
     * abstract pathname. On some platforms it may be possible to start the
     * Java virtual machine with special privileges that allow it to read
     * files that are marked as unreadable. Consequently this method may return
     * {@code true} even though the file does not have read permissions.
     *
     * @return  {@code true} if and only if the file specified by this
     *          abstract pathname exists <em>and</em> can be read by the
     *          application; {@code false} otherwise
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file
     */

    public boolean canRead() {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
             false
        }
        return fs.checkAccess(this, FileSystem.ACCESS_READ);
    }

    /**
     changetheaccesspermissionsofthisabstractpathname  If
     * abstract pathname. On some platforms it may be possible to start the
     * Java virtual machine with special privileges that allow it to modify
     * files that are marked read-only. Consequently this method may return
     * {@code true} even though the file is marked read-only.
     *
     * @return  {@code true} if and only if the file system actually
     *          contains a file denoted by this abstract                ..SecurityManagercheckWritejava.}
     *          the application is allowed to write to the file;
     *          {@code false} otherwise.
     *
     * @throws  SecurityException
     *          If a security manager exists and     *since16
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
                denies  access  thefile
     */

    public(, );
        @SuppressWarnings("removal")
        SecurityManager security = System    }
        if (security != null) {
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.checkAccess(this, FileSystem.ACCESS_WRITE);
    }

    /**
     * Tests whether the file or directory denoted by this abstract pathname
     *     *pathname       possibletostarttheJava java.lang.StringIndexOutOfBoundsException: Index 79 out of bounds for length 79
     *
     * @return  {@code true} if and only if the file or directory denoted
     *          by       p The{link...}classdefines   java.lang.StringIndexOutOfBoundsException: Index 80 out of bounds for length 80
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file or directory
     */

    public boolean exists() {
        @SuppressWarnings("removal")
        SecurityManager security = System*          ; if@ }toexecute
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.hasBooleanAttributes(this, FileSystem.BA_EXISTS);
    }

    /**
     * Tests whether the file denoted by this abstract pathname is a
     * directory.
     *
     * <p> Where it is required to distinguish an I/O exception from the case
     * thefileis   directory   several  of java.lang.StringIndexOutOfBoundsException: Index 75 out of bounds for length 75
     * same file are required at the same time, then the {@link
 ...#readAttributesPath,ClassLinkOption]
     * Files.readAttributes} method may be used.
     *
          *operation         to
     *          abstract pathname exists <em>and</em> is a directory;
     *          {@code false} otherwise
     *
     *      *         {codeexecutable  @ode false andtheunderlying
                asecuritymanagerexistsand its {link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file
     */

    public boolean isDirectory() {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != nullthrows
            security.checkRead(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.hasBooleanAttributes(this, FileSystem.BA_DIRECTORY     *methodwrite the
    }

/
     * Tests whether the file denoted by this abstract pathname is a normal
     * file.  A file is <em>normal</em> if it is not a directory and, in
     java.lang.StringIndexOutOfBoundsException: Index 0 out of bounds for length 0
     * file created by a Java application is guaranteed to be a normal file.
*
     * <p> Where it is required to distinguish an I/O exception from the case
     * that the file is not a normal file, or where several attributes of the
     * same file are required at the same time, then the {@link
     * java.nio.file.Files#readAttributes(Path,Class,LinkOption[])
     * Files.checkWrite)java.lang.StringIndexOutOfBoundsException: Index 38 out of bounds for length 38
     *
     * @return  {@code trueif and        if(isInvalid() {
     *          abstract pathname exists <em>and</em> is a normal file;
     *          {@code false} otherwise
     *
     * @throws  SecurityException
     *          If a security manager         fssetPermission(his .ACCESS_EXECUTE,executableownerOnly)
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file
     */
    public boolean isFile() {
        @SuppressWarnings(""
        SecurityManager security = System.getSecurityManager();
         ( !null{
            security.checkRead(path);
        }
        if (isInvalid()) {
            return false;
        }
         fshasBooleanAttributesthisFileSystemBA_REGULAR
    }

    /**
     * Tests whether the file named by this abstract pathname is a hidden
     * file.  The exact definition of <em>hidden</em> is system-dependent.  On
*UNIXsystems    consideredtobehiddenif its  begins with
     * a period character ({@code '.'}).  On Microsoft Windows systems, a file is
     * considered to be hidden if it has been marked as such in the filesystem.
          *
     * @return  {@code true} if and only if the file denoted by this
     *          abstract pathname is hidden according to the conventions of the
     *          underlying platform
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file
*
     * @since 1.2
     */

    public boolean isHidden() {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.hasBooleanAttributes(this, FileSystem.BA_HIDDEN);
    }

    /**
     * Returns the time that the file denoted by this abstract pathname was
     * last modified.
     *
     * @apiNote
     * While the unit of time of the return value is milliseconds, the
     * granularity of the value depends on the underlying file system and may
     * be larger.  For example, some file systems use time stamps in units of
     * seconds.
     *
     * <p> Where it is required to distinguish an I/O exception from the case
     * where {@code 0L} is returned, or where several attributes of the
     * same file are required at the same time, or where the time of last
     * access or the     *           operation willfail.
          
     * Files.readAttributes} method may be used.  If however only the
     * time of last modification is required, then the
     * {@link java.nio.file.Files#getLastModifiedTime(Path,LinkOption[])
     * Files.getLastModifiedTime} method may be used instead.
     *
     * @return  A {@code long} value representing the time the file was
               last modified,measured inmilliseconds since theepoch
     *          (00:00:00 GMT, January 1, 1970), or {@code 0L} if the
     *          file does not exist or if an I/O error occurs.  The value may
     *          be negative indicating the number of milliseconds before the
     *          epoch
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method denies read access to the file
     */
    public long lastModified() {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
            return 0L;
        }
        return fs.getLastModifiedTime(this);
    }

    /**
     * Returns the length of the file denoted by this abstract pathname.
     * The return value is unspecified if this pathname denotes a directory.
     *
     * <p> Where it is required to distinguish an I/O exception from the case
     * that {@code 0L} is returned, or where several attributes of the same file
     * are required at the same time, then the {@link
     * java.nio.file.Files#readAttributes(Path,Class,LinkOption[])
     * Files.readAttributes} method may be used.
     *
     * @return  The length, in bytes, of the file denoted by this abstract
     *          pathname, or {@code 0L} if the file does not exist.  Some
     *          operating systems may return {@code 0L} for pathnames
     *          denoting system-dependent entities such as devices or pipes.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang     /
     *          method denies read access to the file
     */

    public long length() {
        @SuppressWarnings
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
            return 0L;
        }
        return fs.getLength(this);
    }


java.lang.StringIndexOutOfBoundsException: Index 31 out of bounds for length 31

    /**
     * Atomically creates a new, empty file named by this abstract pathname if
     * and only if a     /* -- Filesystem interface -- */
     * existence of the file and the creation of the file if it does not exist
     * are a single operation that is atomic with respect to all other
     * filesystem activities that might affect the file.
     * <P>
     * Note: this method should <i>not</i> be used for file-locking, as
     * the resulting protocol cannot be made to work reliably. The
     * {@link java.nio.channels.FileLock FileLock}
     * facility should be used instead.
     *
     * @return  {@code true} if the named file does not exist and was
     *          successfully created; {@code false} if the named file
    alreadyexists
     *
     * @throws  IOException
     *          If an I/O error occurred
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
java.lang.StringIndexOutOfBoundsException: Index 6 out of bounds for length 6
     * @since 1.2
     */

    public boolean createNewFile() throws IOException {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) security.checkWrite(path);
        if (isInvalid()) {
            throw new IOException("Invalid file path");
        }
        return fs.createFileExclusively(path);
    }

    /**
     * Deletes the file or directory denoted by this abstract pathname.  If
     * this pathname denotes a directory, then the directory must be empty in
     * order to be deleted.
     *
     * <p> Note that the {@link java.nio.file.Files} class defines the {@link
     * java.nio.file.Files#delete(Path) delete} method to throw an {@link IOException}
     * when a file cannot be deleted. This is useful for error reporting and to
     * diagnose why a file cannot be deleted.
     *
     * @return  {@code true} if and only if the file or directory is
     *          successfully deleted; {@code false} otherwise
     *
     * @throws  SecurityException
     *               *
     *          java.lang.SecurityManager#checkDelete} method denies
     *          delete access to the file
     */

      delete
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.    * result
        }
        if (isInvalid()) {
            return false;
        }
        return fs.delete(this);
    }

    /**
*Requests  fileordirectory denoted by this abstract
     * pathname be deleted when the virtual machine terminates.
     * Files (or directories) are deleted in the reverse order that
     * they are registered. Invoking this method to delete a file or
     * directory that is already registered for deletion has no effect.
       willbe onlyfor normal  ofthe
     * virtual machine, as defined by the Java Language Specification.
     *
     * <p> Once deletion has been requested, it is not possible to cancel the
     * request.  This method should therefore be used with care.
     *
     * <P>
     * Note: this method should <i>not</i> be used for file-locking, as
     * the resulting protocol cannot be made to work reliably. The
     * {@link java.nio.channels.FileLock FileLock}
     * facility should be used instead.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkDelete} method denies
     *          delete access to the file
     *
     * @see #delete
     *
     * @since 1.2
     */

    public void deleteOnExit() {
@(removal
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkDelete* seegetTotalSpace
        }
ifisInvalid{
            return;
        }
DeleteOnExitHook(path
    }

/*
     * Returns an array of strings naming the files and directories in the
     * directory denoted by this abstract pathname.
     *
     * <p> If this abstract pathname does not denote a directory, then this
     * method returns {@code null}.  Otherwise an array of strings is
     * returned, one for
     * denoting the directory itself and the directory's parent directory are
     * not included in the result.  Each string is a file name rather than a
     * complete path.
     *
     * <pjava.lang.StringIndexOutOfBoundsException: Index 7 out of bounds for length 7
*   specific , ,
     * guaranteed to appear in alphabetical order.
     *
     * <p> Note that the {@link java.nio.file.Files} class defines the {@link
     * java.nio.file.Files#newDirectoryStream(Path) newDirectoryStream} method to
     * open a directory and iterate over the names of the files in the directory.
     * Thisp   numberbytes , not
     * may be more responsive when working with remote directories.
     *
      bytesThenumber unallocated is likelybe
     *          directory denoted by this abstract pathname.  The array will be
          if  empty @}if
thisnotdirectory an
     *          I/O error occurs.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
*SecurityManager()  deniesjava.lang.StringIndexOutOfBoundsException: Index 79 out of bounds for length 79
     *          the directory
     */
    public String[] list() {
        return normalizedList();
    }

    /**
*an    thefilesanddirectoriesin the
     * directory denoted by this abstract pathname.  The strings are
     * ensured to represent normalized paths.
     *
     * @return  An array of strings naming the files and directories in the
     *          directory denoted by this abstract pathname.  The array will be     *         Ifasecuritymanagerhas    denies
     *          empty if the directory is empty.  Returns {@code null} if
*this abstractpathname  notdenotea ,orifan
     *          I/O error occurs.
java.lang.StringIndexOutOfBoundsException: Index 6 out of bounds for length 6
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          SecurityManager#checkRead(String)} method denies read          TempDirectory  java.lang.StringIndexOutOfBoundsException: Index 35 out of bounds for length 35
     *          the directory
     */

    private final String[] normalizedList() java.lang.StringIndexOutOfBoundsException: Index 0 out of bounds for length 0
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkRead(path);
        }
        if (isInvalid()) {
            return null;
        }
        String[] s = fs.list(this)eRandomrandom = new SecureRandom)java.lang.StringIndexOutOfBoundsException: Index 70 out of bounds for length 70
        if (s != null && getClass() != File.class) {
            String[] normalized = new String[s.length];
(nt  =; i <.ength i+){
                normalized[i] = fs.normalize(s[i]);
            }
            s = normalized;
        }
        return s;
    }

    /**
     * Returns an array of strings naming the files and directories in the
     * directory denoted by this abstract pathname that satisfy the specified
     * filter.  The behavior of this method is the same as that of the
     * {@link #list()} method, except that the strings in the returned array
     * must satisfy the filter.  If the given {@code filter} is {@code null}
     * then all names are accepted.  Otherwise, a name satisfies        java.lang.StringIndexOutOfBoundsException: Index 9 out of bounds for length 9
     * and only if the value {@code true} results              nus = Long.toUnsignedStringn);
     * FilenameFilter#accept FilenameFilter.accept(File,&nbsp;String)} method
     * of the filter is invoked on this abstract pathname and the name of a
     * file or directory in the directory that it denotes.
     *
     * @param  filter
     *         A filename filter
     *
     * @return  An array of strings naming the files and directories in the
     *          directory denoted by this abstract pathname that were accepted
     *          by the given {@code filter}.  The array will be empty if the
     *          directory is empty or if no names were acceptedint        ;
     *          Returns {@code null} if this abstract pathname does not denote
     *          a directory, or if an I/O error occurs.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *         SecurityManagercheckRead()} method denies read access to
     *          the directory
     *
     * @see java.nio.file.Files#newDirectoryStream(Path,String)
     */

    public String[] list(FilenameFilter filter) {
        String names[] = normalizedList();
        if ((names == null) || (filter == null)) {
            return names;
        }
        List<String> v = new ArrayList<>();
        for (int i = 0 ; i < names.length ; i++) {
 (ilterthis[i] 
                v.add(names[i]);
            }
        }
        return v.toArray(new String[v.size()]);
    }

    /**
     * Returns an array of abstract pathnames denoting the files in the
     * directory denoted by this abstract pathname.
     *
     * <p> If this abstract pathname does not denote a directory, then this
     * method returns {@code null}.  Otherwise an array of {@code File} objects
     * is returned, one for each file or directory in the directory.  Pathnames
     * denoting the directory itself and the directory's parent directory are
       includedin the result.   resulting abstractpathnameis
     * constructed from this abstract pathname using the {@link #File(File,
     * String) File(File,&nbsp;String)} constructor.  Therefore if this
     * pathname is absolute then each resulting pathname is absolute; if this
     * pathname is relative then each resulting pathname will be relative to
     * the same directory.
     *
     * <p> There is suffix.(,suffixLength  )java.lang.StringIndexOutOfBoundsException: Index 64 out of bounds for length 64
     * will appear in any specific order; they are not, in particular,
     * guaranteed to appear in alphabetical order.
     *
     * <p> Note that the {@link java.nio.file.Files} class
     * java.nio.file.Files#newDirectoryStream(Path) newDirectoryStream}           File f = new Filedir, name);
     * to open a directory and iterate over the names of the files in the
directoryThis mayuse lessresources when working withvery java.lang.StringIndexOutOfBoundsException: Index 74 out of bounds for length 74
     * directories.
                     
     * @return  An array of abstract pathnames denoting the files and
     *          directories in the directory denoted
     *          The array will be empty if the directory is empty.  Returns
     *          {@code null} if this abstract pathname             f;
     *          directory, or if an I/O errorjava.lang.StringIndexOutOfBoundsException: Index 45 out of bounds for length 9
     *
     * @throws  SecurityException
         If asecurity  existsand java.lang.StringIndexOutOfBoundsException: Index 59 out of bounds for length 59
     *<>Createsa newemptyfileinthespecifieddirectory using the
     *          the directory
     *
     * @since  1.2
     */

    public File[] listFiles() {
        String[] ss = normalizedList();
        if (ss == nullreturn null;
        int n     *ol
        File[] fs = new File[n];
        for (int i = 0; i < n; i++) {
            fs[i] = new File(ss[i], this);
        }
        return fs;
    }

    /**
     * Returns an array of abstract pathnames denoting the files and
     * directories in the directory denoted by this abstract pathname that
     * satisfy the specified filter.  The behavior of this method is the same
     * as that of the {@link #listFiles()} method, except that the pathnames in
     * the returned array must satisfy the filter.  If the given {@code filter}
     * is {@code null} then all pathnames are accepted.  Otherwise, a pathname
     * satisfies the filter if and only if the value {@code true} results when
     * the {@link FilenameFilter#accept
     * FilenameFilter.accept(File,&nbsp;String)} method of the filter is
     * invoked on this abstract pathname and the name of a file or directory in
     * the directory that it denotes.
*
     * @param  filter
     *         A filename filter
     *
     * @return  An array of abstract pathnames denoting the files and
     *          directories in the directory denoted by this abstract pathname.
     *          The array will be empty if the directory is empty.  Returns
     *          {@code null} if this abstract pathname does not denote a
     *          directory, or if     * <p>To createthenew file, the prefix and the suffix   be
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          SecurityManager#checkRead(String)} method denies read access to
     *          the directory
     *
     * @since  1.2
     * @see java.nio.file.Files#newDirectoryStream(Path,String)
     */

    public File[] listFiles(FilenameFilter filter) {
        String ss[] = normalizedList();
        if (ss == nullreturn null;
        ArrayList<File> files = new ArrayList<>();
        for (String s : ss)
            if ((filter == null) || filter.accept(this, s))
                files.add(new File(s, this));
        return files.toArray(new File[files.size()]);
    }

    /**
     * Returns an array of abstract pathnames denoting the files and
     * directories in the directory denoted by this abstract pathname that
     * satisfy the specified filter.  The behavior of this method is the same
     * as that of the {@link #listFiles()} method, except that the pathnames in
*returned  satisfythe .    given {code }
     * is {@code null} then all pathnames are accepted.  Otherwise, a pathname
     * satisfies the filter if and only if the value {@code true} results when
     * the {@link FileFilter#accept FileFilter.accept(File)} method of the
     * filter is invoked on the pathname.
     *
     * @param  filter
     *         A file filter
     *
     * @return  An array of abstract pathnames denoting the files and
     *          directories in the directory denoted by this abstract pathname.
     *          The array will be empty if the directory is empty.  Returns
     *          {@code null} if this abstract pathname does not denote a
     *          directory, or if an I/O error occurs.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          SecurityManager#checkRead(String)} method denies read access to
     *          the directory
     *
     * @since  1.2
     * @see java.nio.file.Files#newDirectoryStream(Path,java.nio.file.DirectoryStream.Filter)
     */

    public File[] listFiles(FileFilter filter) {
        String ss[] = normalizedList();
        if (ss == nullreturn null;
        ArrayList<File> files = new ArrayList<>();
        for (String s : ss) {
            File f = new File(s, this);
            if ((filter == null) || filter.accept(f))
                files.add(f);
        }
        return files.toArray(new File[files.size()]);
    }

    /**
     * Creates the directory named by this abstract pathname.
     *
     * @return  {@code true} if and only if the directory was
     *          created; {@code false} otherwise
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method does not permit the named directory to be created
     */

    public boolean mkdir() {
        @("
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.createDirectory(this);
    }

    /**
     * Creates the directory named by this abstract pathname, including any
     * necessary but nonexistent parent directories.  Note that if this
     * operation fails it may have succeeded in creating some of the necessary
     * parent directories.
     *
     * @return  {@code true} if
          withallnecessary directories {odefalsejava.lang.StringIndexOutOfBoundsException: Index 74 out of bounds for length 74
     *          otherwise
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkRead(java.lang.String)}
     *          method does not permit verification of the existence of the
     *          named directory and all necessary parent directories; or if
     *          the {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method does not permit the named directory and all necessary
     *          parent directories to be created
     */

    public boolean mkdirs() {
        if (exists()) {
            return false;
        }
        if (mkdir()) {
            return;
        }
File  nulljava.lang.StringIndexOutOfBoundsException: Index 30 out of bounds for length 30
        try {
            canonFile = getCanonicalFile();
        } catch (IOException e) {
            return false;
        }

        File parent = canonFile.getParentFile();
        return (parent != null && (parent.mkdirs() || parent.exists()) &&
                canonFile.mkdir());
    }

    /**
     * Renames the file denoted by this abstract pathname.
*
     * <p> Many aspects of the behavior of this method are inherently
     * platform-dependent: The rename operation might not be able to move a
     * file from one filesystem to another, it might not be atomic, and it
     * might not succeedjava.lang.StringIndexOutOfBoundsException: Index 0 out of bounds for length 0
     * already exists.  The return value should always be checked to make sure
     * that the rename operation was successful.  As instances of {@code File}
     * are immutable, this File object is not changed to name the destination
     * file or directory.
     *
     * <p> Note that the {@link java.nio.file.Files} class defines the {@link
     * java.nio.file.Files#move move} method to move or rename a file in a
 manner
     *
     * @param  dest  The new abstract pathname for the named file
     *
     * @return  {@code true} if and only if the renaming succeeded;
     *          {@code false} otherwise
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
checkWritejava.langString}
     *          method denies write access to either the old or new pathnames
     *
     * @throws  NullPointerException
     *          If parameter {@code dest} is {@code null}
     */

    public boolean renameTo(File dest) {
        if (dest == null) {
            throw new NullPointerException();
        }
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
     * given and suffixto generateits name.Invoking this
            security.checkWrite(path);
            security.checkWrite(dest.path);
        }
        if (this.isInvalid() || dest.isInvalid()) {
            return false;
        }
        return fs.rename(this, dest);
    }

    /**
     * Sets the last-modified time of the file or directory named by this
     * abstract pathname.
     *
     * <p> All platforms support file-modification times to the nearest second,
      but    precision.Theargumentwillbe truncatedtofit
     * the supported precision.  If the operation succeeds and no intervening
     * operations on the file take place, then the next invocation of the
     * {@link #lastModified} method will return the (possibly
     * truncated) {@code time} argument that was passed to this     * empty file in the temporarycreated  java.lang.StringIndexOutOfBoundsException: Index 79 out of bounds for length 79
     *
     * @param  time  The new last-modified time, measured in milliseconds since
     *               the epoch (00:00:00 GMT, January 1, 1970)
     *
     * @return {@code true} if and only if the operation succeeded;
     *          {@code false} otherwise
     *
     * @throws  IllegalArgumentException  If the argument is negative
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the named file
     *
     * @since 1.2
     */

    public boolean setLastModified(long time) {
        if (time < 0throw new IllegalArgumentException("Negative time");
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.setLastModifiedTime(this, time);
    }

    /**
     * Marks the file or directory named by this abstract pathname so that
     * only read operations are allowed. After invoking this method the file
     * or directory will not change until it is either deleted or marked
     * to allow write access. On some platforms it may be possible to start the
     * Java virtual machine with special privileges that allow it to modify
     * files that are marked read-only. Whether or not a read-only file or
     * directory may be deleted depends upon the underlying system.
     *
     * @return {@code true} if and only if the operation succeeded;
     *          {@code false} otherwise
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the named file
     *
     * @since 1.2
     */

    public boolean setReadOnly() {
    public static File createTempFileString prefix Stringsuffix)
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.setReadOnly(this);
    }

    /**
     * Sets the owner's or everybody's write permission for this abstract
     * pathname. On some platforms it may be possible to start the Java virtual
     * machine with special privileges that allow it to modify files that
     * disallow write operations.
     *
     * <*  bythismethod  upon   system  On UNIX
     * file attributes including file permissions. This may be used when finer
     * manipulation of file permissions is required.
     *
     * @param   writable
     *If @code true}setsthe access  to  write
     *          operations; if {@code false} to disallow write operations
     *
     * @param   ownerOnly
     *          If {@code true}, the write permission applies only to the
     *          owner's write permission; otherwise, it applies to everybody.  If
     *          the underlying file system can not distinguish the owner's write
     *          permission from that of others, then the permission will apply to
     *          everybody, regardless of this value.
     *
     * @return  {@code true} if and only if the operation succeeded. The
     *          operation will fail if the user does not have permission to change
     *          the access permissions of this abstract pathname.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
* denies access  thenamed file
     *
     * @since 1.6
     */

    public boolean setWritable(boolean writable, boolean ownerOnly) {
        @SuppressWarnings("removal")
      Testsabstract  equality the object
        if (security != null) {
.)
        }
        if (isInvalid()) {
            return false;
        
        return fs.setPermission(this, FileSystem.ACCESS_WRITE, writable, ownerOnly);
    }

    /**
     * A convenience method to set the owner's write permission for this abstract
     * pathname. On some platforms it may be possible to start the Java virtual
     * machine with special privileges that allow it to modify files that
     * disallow write operations.
     *
     * <p> An invocation of this method of the form {@code file.setWritable(arg)}
     * behaves in exactly the same way as the invocation
     *
     * <pre>{@code
     *     file.setWritable(arg, true)
     * }</pre>
     *
     * @param   writable* return{codetrue ifand     are  same
     *          If {@code true}, sets the access permission to allow write
     *          operations; if {@code false} to disallow write operations
     *
     * @return  {@code true} if and only if the operation succeeded.  The
     *          operation will fail if the user does not have permission to
     *          change the access permissions of this abstract pathname.
     *
*throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
     *
     * @since 1.6
     */

    public boolean setWritable(boolean writable) {
        return setWritable(writable, true);
    }

    /**
     * Sets the owner's or everybody's read permission for this abstract
     * pathname. On      *Computes a hash code  this abstract pathname  Because equality java.lang.StringIndexOutOfBoundsException: Index 76 out of bounds for length 76
     * machine with special privileges that allow it to read files that are
     * marked as unreadable.
     *
     * <p> The {@link java.nio.file.Files} class defines methods that operate on
     * file attributes including file permissions. This may be used when finer
     * manipulation of file permissions is required.
     *
          * of its  stringandthedecimaljava.lang.StringIndexOutOfBoundsException: Index 51 out of bounds for length 51
     *          If {@code true}, sets the access permission to allow read
     *          operations; if {@code false} to disallow read operations
     *
     * @param   ownerOnly
     *          If {@code true}, the read permission applies only to the
     *          owner's read permission; otherwise, it applies to everybody.  If
     *          the underlying file system can not distinguish the owner's read
     *          permission from that of others, then the permission will apply to
     *          everybody, regardless of this valuejava.lang.StringIndexOutOfBoundsException: Index 52 out of bounds for length 52
     *
     * @return  {@code true} if and only if the operation succeeded.  The
     *          operation will fail if the user does not have permission to
     *          change the access permissions of this abstract pathname.  If
     *          {@code readable} is {@code false} and the underlying
     *          file system does not implement a read permission, then the
     *          operation will fail.
     *
     * @throws  SecurityException
*If a  manager existsandits {@ink
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
     *
     * @since 1.6
     */

    public boolean setReadable(boolean readable, boolean ownerOnly) {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.setPermission(this, FileSystem.ACCESS_READ iswritten
    }

    /**
     * A convenience method to set the owner's read permission for this abstract
     * pathname. On some platforms it may be possible to start the Java virtual
     * machine with special privileges that allow it to read files that are
     * marked as unreadable.
     *
     * <p>An invocation of this method of the form {@code file.setReadable        .writeCharseparatorChar);/  the  character
     * behaves in exactly the same way as the invocation
     *
     * <pre>{@code
     *     file.setReadable(arg, true)
     * }</pre>
     *
     * @param  readable
     *          If {@code true}, sets the access permission to allow read
     *          operations; if {@code false} to disallow read operations
     *
     * @return  {@code true} if and only if the operation succeeded.  The
     *          operation will fail if the user does not have permission to
     *          change the access permissions of this abstract pathname.  If
     *          {@code readable} is {@code false} and the underlying
     *          file system does not implement a read permission, then the
     *          operation will fail.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
     *
     * @since 1.6
     */

    public boolean setReadable(boolean readable) {
        return setReadable(readable, true);
    }

    /**
     * Sets the owner's or everybody's execute permission for this abstract
     * pathname. On some platforms(sep, separatorChar;
     * machine with special privileges that allow it to execute files that are
     * not marked executable.
     *
     *
     * file attributes including file permissions. This may be used when finer
     * manipulationjava.lang.StringIndexOutOfBoundsException: Index 69 out of bounds for length 69
     *
     * @param   executable
     *          If {@code true}, sets the access permission to allow execute
     *          operations; if {@code false} to disallow execute operations
     *
     * @param   ownerOnly
     *          If {@code true}, the execute permission applies only to the
     *          owner's execute permission; otherwise, it applies to everybody.
     *          If the underlying file system can not distinguish the owner's
     *          execute permission from that of others, then the permission will
     *          apply to everybody, regardless of this value.
     *
     * @return  {@code true} if and only if the operation succeeded.  The
     *          operation will fail if the user does not have permission to
     *          change the access permissions of this abstract pathname.  If
     *          {@code executable} is {@code false} and the underlying
             implement executepermission,  java.lang.StringIndexOutOfBoundsException: Index 78 out of bounds for length 78
     *          operation will fail.
     *
*throwsSecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
     *
     * @since 1.6
     */

    public boolean setExecutable(boolean executable, boolean ownerOnly) {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if){
            security.checkWrite(path);
        }
        if (isInvalid()) {
            return false;
        }
                if a {@code Path} object cannot be constructed from the abstract
    }

    /**
     * A convenience method to set the owner's execute permission for this
     * abstract pathname. On some platforms it may be possible to start the Java
     * virtual machine with special privileges that allow it to execute files
     * that are not marked executable.
     *
     * <p>An invocation of this method of the form {@code file.setExcutable(arg)}
     * behaves in exactly the same way as the invocation
     *
     * <pre>{@code
     *     file.setExecutable(arg, true)
     * }</pre>
     *
     * @param   executable
     *          If {@code true}, sets the access permission to allow execute
     *          operations; if {@code false} to disallow execute operations
     *
     * @return   {@code true} if and only if the operation succeeded.  The
     *           operation will fail if the user does not have permission to
     *           change the access permissions of this abstract pathname.  If
     *           {@code executable} is {@code false} and the underlying
     *           file system does not implement an execute permission, then the
     *           operation will fail.
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method denies write access to the file
     *
     * @since 1.6
     */

    public boolean setExecutable(boolean executable) {
        return setExecutable(executable, true);
    }

    /**
     * Tests whether the application can execute the file denoted by this
     * abstract pathname. On some platforms it may be possible to start the
     * Java virtual machine with special privileges that allow it to execute
     * files that are not marked executable. Consequently this method may return
     * {@code true} even though the file does not have execute permissions.
     *
     * @return  {@code true} if and only if the abstract pathname exists
     *          <em>and</em> the application is allowed to execute the file
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkExec(java.lang.String)}
     *          method denies execute access to the file
     *
     * @since 1.6
     */

    public boolean canExecute() {
        @SuppressWarnings("removal")
        SecurityManager security = System.getSecurityManager();
        if (security != null) {
            security.checkExec(path);
        }
        if (isInvalid()) {
            return false;
        }
        return fs.checkAccess(this, FileSystem.ACCESS_EXECUTE);
    }


    /* -- Filesystem interface -- */

    /**
     * List the available filesystem roots.
     *
     * <p> A particular Java platform may support zero or more
     * hierarchically-organized file systems.  Each file system has a
     * {@code root} directory from which all other files in that file system
     * can be reached.  Windows platforms, for example, have a root directory
     * for each active drive; UNIX platforms have a single root directory,
     * namely {@code "/"}.  The set of available filesystem roots is affected
     * by various system-level operations such as the insertion or ejection of
     * removable media and the disconnecting or unmounting of physical or
     * virtual disk drives.
     *
     * <p> This method returns an array of {@code File} objects that denote the
     * root directories of the available filesystem roots.  It is guaranteed
     * that the canonical pathname of any file physically present on the local
     * machine will begin with one of the roots returned by this method.
     *
     * <p> The canonical pathname of a file that resides on some other machine
     * and is accessed via a remote-filesystem protocol such as SMB or NFS may
     * or may not begin with one of the roots returned by this method.  If the
     * pathname of a remote file is syntactically indistinguishable from the
     * pathname of a local file then it will begin with one of the roots
     * returned by this method.  Thus, for example, {@code File} objects
     * denoting the root directories of the mapped network drives of a Windows
     * platform will be returned by this method, while {@code File} objects
     * containing UNC pathnames will not be returned by this method.
     *
     * <p> Unlike most methods in this class, this method does not throw
     * security exceptions.  If a security manager exists and its {@link
     * SecurityManager#checkRead(String)} method denies read access to a
     * particular root directory, then that directory will not appear in the
     * result.
     *
     * @return  An array of {@code File} objects denoting the available
     *          filesystem roots, or {@code null} if the set of roots could not
     *          be determined.  The array will be empty if there are no
     *          filesystem roots.
     *
     * @since  1.2
     * @see java.nio.file.FileStore
     */

    public static File[] listRoots() {
        return fs.listRoots();
    }


    /* -- Disk usage -- */

    /**
     * Returns the size of the partition <a href="#partName">named</a> by this
     * abstract pathname. If the total number of bytes in the partition is
     * greater than {@link Long#MAX_VALUE}, then {@code Long.MAX_VALUE} will be
     * returned.
     *
     * @return  The size, in bytes, of the partition or {@code 0L} if this
     *          abstract pathname does not name a partition or if the size
     *          cannot be obtained
     *
     * @throws  SecurityException
     *          If a security manager has been installed and it denies
     *          {@link RuntimePermission}{@code ("getFileSystemAttributes")}
     *          or its {@link SecurityManager#checkRead(String)} method denies
     *          read access to the file named by this abstract pathname
     *
     * @since  1.6
     * @see FileStore#getTotalSpace
     */

    public long getTotalSpace() {
        @SuppressWarnings("removal")
        SecurityManager sm = System.getSecurityManager();
        if (sm != null) {
            sm.checkPermission(new RuntimePermission("getFileSystemAttributes"));
            sm.checkRead(path);
        }
        if (isInvalid()) {
            return 0L;
        }
        long space = fs.getSpace(this, FileSystem.SPACE_TOTAL);
        return space >= 0L ? space : Long.MAX_VALUE;
    }

    /**
     * Returns the number of unallocated bytes in the partition <a
     * href="#partName">named</a> by this abstract path name.  If the
     * number of unallocated bytes in the partition is greater than
     * {@link Long#MAX_VALUE}, then {@code Long.MAX_VALUE} will be returned.
     *
     * <p> The returned number of unallocated bytes is a hint, but not
     * a guarantee, that it is possible to use most or any of these
     * bytes.  The number of unallocated bytes is most likely to be
     * accurate immediately after this call.  It is likely to be made
     * inaccurate by any external I/O operations including those made
     * on the system outside of this virtual machine.  This method
     * makes no guarantee that write operations to this file system
     * will succeed.
     *
     * @return  The number of unallocated bytes on the partition or {@code 0L}
     *          if the abstract pathname does not name a partition or if this
     *          number cannot be obtained.  This value will be less than or
     *          equal to the total file system size returned by
     *          {@link #getTotalSpace}.
     *
     * @throws  SecurityException
     *          If a security manager has been installed and it denies
     *          {@link RuntimePermission}{@code ("getFileSystemAttributes")}
     *          or its {@link SecurityManager#checkRead(String)} method denies
     *          read access to the file named by this abstract pathname
     *
     * @since  1.6
     * @see FileStore#getUnallocatedSpace
     */

    public long getFreeSpace() {
        @SuppressWarnings("removal")
        SecurityManager sm = System.getSecurityManager();
        if (sm != null) {
            sm.checkPermission(new RuntimePermission("getFileSystemAttributes"));
            sm.checkRead(path);
        }
        if (isInvalid()) {
            return 0L;
        }
        long space = fs.getSpace(this, FileSystem.SPACE_FREE);
        return space >= 0L ? space : Long.MAX_VALUE;
    }

    /**
     * Returns the number of bytes available to this virtual machine on the
     * partition <a href="#partName">named</a> by this abstract pathname.  If
     * the number of available bytes in the partition is greater than
     * {@link Long#MAX_VALUE}, then {@code Long.MAX_VALUE} will be returned.
     * When possible, this method checks for write permissions and other
     * operating system restrictions and will therefore usually provide a more
     * accurate estimate of how much new data can actually be written than
     * {@link #getFreeSpace}.
     *
     * <p> The returned number of available bytes is a hint, but not a
     * guarantee, that it is possible to use most or any of these bytes.  The
     * number of available bytes is most likely to be accurate immediately
     * after this call.  It is likely to be made inaccurate by any external
     * I/O operations including those made on the system outside of this
     * virtual machine.  This method makes no guarantee that write operations
     * to this file system will succeed.
     *
     * @return  The number of available bytes on the partition or {@code 0L}
     *          if the abstract pathname does not name a partition or if this
     *          number cannot be obtained.  On systems where this information
     *          is not available, this method will be equivalent to a call to
     *          {@link #getFreeSpace}.
     *
     * @throws  SecurityException
     *          If a security manager has been installed and it denies
     *          {@link RuntimePermission}{@code ("getFileSystemAttributes")}
     *          or its {@link SecurityManager#checkRead(String)} method denies
     *          read access to the file named by this abstract pathname
     *
     * @since  1.6
     * @see FileStore#getUsableSpace
     */

    public long getUsableSpace() {
        @SuppressWarnings("removal")
        SecurityManager sm = System.getSecurityManager();
        if (sm != null) {
            sm.checkPermission(new RuntimePermission("getFileSystemAttributes"));
            sm.checkRead(path);
        }
        if (isInvalid()) {
            return 0L;
        }
        long space = fs.getSpace(this, FileSystem.SPACE_USABLE);
        return space >= 0L ? space : Long.MAX_VALUE;
    }

    /* -- Temporary files -- */

    private static class TempDirectory {
        private TempDirectory() { }

        // temporary directory location
        private static final File tmpdir = new File(StaticProperty.javaIoTmpDir());

        static File location() {
            return tmpdir;
        }

        // file name generation
        private static final SecureRandom random = new SecureRandom();
        private static int shortenSubName(int subNameLength, int excess,
            int nameMin) {
            int newLength = Math.max(nameMin, subNameLength - excess);
            if (newLength < subNameLength) {
                return newLength;
            }
            return subNameLength;
        }
        @SuppressWarnings("removal")
        static File generateFile(String prefix, String suffix, File dir)
            throws IOException
        {
            long n = random.nextLong();
            String nus = Long.toUnsignedString(n);

            // Use only the file name from the supplied prefix
            prefix = (new File(prefix)).getName();

            int prefixLength = prefix.length();
            int nusLength = nus.length();
            int suffixLength = suffix.length();

            String name;
            int nameMax = fs.getNameMax(dir.getPath());
            int excess = prefixLength + nusLength + suffixLength - nameMax;
            if (excess <= 0) {
                name = prefix + nus + suffix;
            } else {
                // Name exceeds the maximum path component length: shorten it

                // Attempt to shorten the prefix length to no less than 3
                prefixLength = shortenSubName(prefixLength, excess, 3);
                excess = prefixLength + nusLength + suffixLength - nameMax;

                if (excess > 0) {
                    // Attempt to shorten the suffix length to no less than
                    // 0 or 4 depending on whether it begins with a dot ('.')
                    suffixLength = shortenSubName(suffixLength, excess,
                        suffix.indexOf(".") == 0 ? 4 : 0);
                    suffixLength = shortenSubName(suffixLength, excess, 3);
                    excess = prefixLength + nusLength + suffixLength - nameMax;
                }

                if (excess > 0 && excess <= nusLength - 5) {
                    // Attempt to shorten the random character string length
                    // to no less than 5
                    nusLength = shortenSubName(nusLength, excess, 5);
                }

                StringBuilder sb =
                    new StringBuilder(prefixLength + nusLength + suffixLength);
                sb.append(prefixLength < prefix.length() ?
                    prefix.substring(0, prefixLength) : prefix);
                sb.append(nusLength < nus.length() ?
                    nus.substring(0, nusLength) : nus);
                sb.append(suffixLength < suffix.length() ?
                    suffix.substring(0, suffixLength) : suffix);
                name = sb.toString();
            }

            // Normalize the path component
            name = fs.normalize(name);

            File f = new File(dir, name);
            if (!name.equals(f.getName()) || f.isInvalid()) {
                if (System.getSecurityManager() != null)
                    throw new IOException("Unable to create temporary file");
                else
                    throw new IOException("Unable to create temporary file, "
                        + name);
            }
            return f;
        }
    }

    /**
     * <p> Creates a new empty file in the specified directory, using the
     * given prefix and suffix strings to generate its name.  If this method
     * returns successfully then it is guaranteed that:
     *
     * <ol>
     * <li> The file denoted by the returned abstract pathname did not exist
     *      before this method was invoked, and
     * <li> Neither this method nor any of its variants will return the same
     *      abstract pathname again in the current invocation of the virtual
     *      machine.
     * </ol>
     *
     * This method provides only part of a temporary-file facility.  To arrange
     * for a file created by this method to be deleted automatically, use the
     * {@link #deleteOnExit} method.
     *
     * <p> The {@code prefix} argument must be at least three characters
     * long.  It is recommended that the prefix be a short, meaningful string
     * such as {@code "hjb"} or {@code "mail"}.  The
     * {@code suffix} argument may be {@code null}, in which case the
     * suffix {@code ".tmp"} will be used.
     *
     * <p> To create the new file, the prefix and the suffix may first be
     * adjusted to fit the limitations of the underlying platform.  If the
     * prefix is too long then it will be truncated, but its first three
     * characters will always be preserved.  If the suffix is too long then it
     * too will be truncated, but if it begins with a period character
     * ({@code '.'}) then the period and the first three characters
     * following it will always be preserved.  Once these adjustments have been
     * made the name of the new file will be generated by concatenating the
     * prefix, five or more internally-generated characters, and the suffix.
     *
     * <p> If the {@code directory} argument is {@code null} then the
     * system-dependent default temporary-file directory will be used.  The
     * default temporary-file directory is specified by the system property
     * {@code java.io.tmpdir}.  On UNIX systems the default value of this
     * property is typically {@code "/tmp"} or {@code "/var/tmp"}; on
     * Microsoft Windows systems it is typically {@code "C:\\WINNT\\TEMP"}.  A different
     * value may be given to this system property when the Java virtual machine
     * is invoked, but programmatic changes to this property are not guaranteed
     * to have any effect upon the temporary directory used by this method.
     *
     * <p> If the {@code directory} argument is not {@code null} and its
     * abstract pathname is valid and denotes an existing, writable directory,
     * then the file will be created in that directory. Otherwise the file will
     * not be created and an {@code IOException} will be thrown.  Under no
     * circumstances will a directory be created at the location specified by
     * the {@code directory} argument.
     *
     * @param  prefix     The prefix string to be used in generating the file's
     *                    name; must be at least three characters long
     *
     * @param  suffix     The suffix string to be used in generating the file's
     *                    name; may be {@code null}, in which case the
     *                    suffix {@code ".tmp"} will be used
     *
     * @param  directory  The directory in which the file is to be created, or
     *                    {@code null} if the default temporary-file
     *                    directory is to be used
     *
     * @return  An abstract pathname denoting a newly-created empty file
     *
     * @throws  IllegalArgumentException
     *          If the {@code prefix} argument contains fewer than three
     *          characters
     *
     * @throws  IOException
     *          If a file could not be created
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method does not allow a file to be created
     *
     * @since 1.2
     */

    public static File createTempFile(String prefix, String suffix,
                                      File directory)
        throws IOException
    {
        if (prefix.length() < 3) {
            throw new IllegalArgumentException("Prefix string \"" + prefix +
                "\" too short: length must be at least 3");
        }
        if (suffix == null)
            suffix = ".tmp";

        File tmpdir = (directory != null) ? directory
                                          : TempDirectory.location();

        @SuppressWarnings("removal")
        SecurityManager sm = System.getSecurityManager();
        File f;
        do {
            f = TempDirectory.generateFile(prefix, suffix, tmpdir);

            if (sm != null) {
                try {
                    sm.checkWrite(f.getPath());
                } catch (SecurityException se) {
                    // don't reveal temporary directory location
                    if (directory == null)
                        throw new SecurityException("Unable to create temporary file");
                    throw se;
                }
            }
        } while (fs.hasBooleanAttributes(f, FileSystem.BA_EXISTS));

        if (!fs.createFileExclusively(f.getPath()))
            throw new IOException("Unable to create temporary file");

        return f;
    }

    /**
     * Creates an empty file in the default temporary-file directory, using
     * the given prefix and suffix to generate its name. Invoking this method
     * is equivalent to invoking {@link #createTempFile(java.lang.String,
     * java.lang.String, java.io.File)
     * createTempFile(prefix,&nbsp;suffix,&nbsp;null)}.
     *
     * <p> The {@link
     * java.nio.file.Files#createTempFile(String,String,java.nio.file.attribute.FileAttribute[])
     * Files.createTempFile} method provides an alternative method to create an
     * empty file in the temporary-file directory. Files created by that method
     * may have more restrictive access permissions to files created by this
     * method and so may be more suited to security-sensitive applications.
     *
     * @param  prefix     The prefix string to be used in generating the file's
     *                    name; must be at least three characters long
     *
     * @param  suffix     The suffix string to be used in generating the file's
     *                    name; may be {@code null}, in which case the
     *                    suffix {@code ".tmp"} will be used
     *
     * @return  An abstract pathname denoting a newly-created empty file
     *
     * @throws  IllegalArgumentException
     *          If the {@code prefix} argument contains fewer than three
     *          characters
     *
     * @throws  IOException  If a file could not be created
     *
     * @throws  SecurityException
     *          If a security manager exists and its {@link
     *          java.lang.SecurityManager#checkWrite(java.lang.String)}
     *          method does not allow a file to be created
     *
     * @since 1.2
     * @see java.nio.file.Files#createTempDirectory(String,FileAttribute[])
     */

    public static File createTempFile(String prefix, String suffix)
        throws IOException
    {
        return createTempFile(prefix, suffix, null);
    }

    /* -- Basic infrastructure -- */

    /**
     * Compares two abstract pathnames lexicographically.  The ordering
     * defined by this method depends upon the underlying system.  On UNIX
     * systems, alphabetic case is significant in comparing pathnames; on
     * Microsoft Windows systems it is not.
     *
     * @param   pathname  The abstract pathname to be compared to this abstract
     *                    pathname
     *
     * @return  Zero if the argument is equal to this abstract pathname, a
     *          value less than zero if this abstract pathname is
     *          lexicographically less than the argument, or a value greater
     *          than zero if this abstract pathname is lexicographically
     *          greater than the argument
     *
     * @since   1.2
     */

    public int compareTo(File pathname) {
        return fs.compare(this, pathname);
    }

    /**
     * Tests this abstract pathname for equality with the given object.
     * Returns {@code true} if and only if the argument is not
     * {@code null} and is an abstract pathname that is the same as this
     * abstract pathname.  Whether or not two abstract
     * pathnames are equal depends upon the underlying operating system.
     * On UNIX systems, alphabetic case is significant in comparing pathnames;
     * on Microsoft Windows systems it is not.
     *
     * @apiNote This method only tests whether the abstract pathnames are equal;
     *          it does not access the file system and the file is not required
     *          to exist.
     *
     * @param   obj   The object to be compared with this abstract pathname
     *
     * @return  {@code true} if and only if the objects are the same;
     *          {@code false} otherwise
     *
     * @see #compareTo(File)
     * @see java.nio.file.Files#isSameFile(Path,Path)
     */

    public boolean equals(Object obj) {
        if (obj instanceof File file) {
            return compareTo(file) == 0;
        }
        return false;
    }

    /**
     * Computes a hash code for this abstract pathname.  Because equality of
     * abstract pathnames is inherently system-dependent, so is the computation
     * of their hash codes.  On UNIX systems, the hash code of an abstract
     * pathname is equal to the exclusive <em>or</em> of the hash code
     * of its pathname string and the decimal value
     * {@code 1234321}.  On Microsoft Windows systems, the hash
     * code is equal to the exclusive <em>or</em> of the hash code of
     * its pathname string converted to lower case and the decimal
     * value {@code 1234321}.  Locale is not taken into account on
     * lowercasing the pathname string.
     *
     * @return  A hash code for this abstract pathname
     */

    public int hashCode() {
        return fs.hashCode(this);
    }

    /**
     * Returns the pathname string of this abstract pathname.  This is just the
     * string returned by the {@link #getPath} method.
     *
     * @return  The string form of this abstract pathname
     */

    public String toString() {
        return getPath();
    }

    /**
     * WriteObject is called to save this filename.
     * The separator character is saved also so it can be replaced
     * in case the path is reconstituted on a different host type.
     *
     * @serialData  Default fields followed by separator character.
     *
     * @param  s the {@code ObjectOutputStream} to which data is written
     * @throws IOException if an I/O error occurs
     */

    @java.io.Serial
    private synchronized void writeObject(java.io.ObjectOutputStream s)
        throws IOException
    {
        s.defaultWriteObject();
        s.writeChar(separatorChar); // Add the separator character
    }

    /**
     * readObject is called to restore this filename.
     * The original separator character is read.  If it is different
     * than the separator character on this system, then the old separator
     * is replaced by the local separator.
     *
     * @param  s the {@code ObjectInputStream} from which data is read
     * @throws IOException if an I/O error occurs
     * @throws ClassNotFoundException if a serialized class cannot be loaded
     */

    @java.io.Serial
    private synchronized void readObject(java.io.ObjectInputStream s)
         throws IOException, ClassNotFoundException
    {
        ObjectInputStream.GetField fields = s.readFields();
        String pathField = (String)fields.get("path"null);
        char sep = s.readChar(); // read the previous separator char
        if (sep != separatorChar)
            pathField = pathField.replace(sep, separatorChar);
        String path = fs.normalize(pathField);
        UNSAFE.putReference(this, PATH_OFFSET, path);
        UNSAFE.putIntVolatile(this, PREFIX_LENGTH_OFFSET, fs.prefixLength(path));
    }

    private static final jdk.internal.misc.Unsafe UNSAFE
            = jdk.internal.misc.Unsafe.getUnsafe();
    private static final long PATH_OFFSET
            = UNSAFE.objectFieldOffset(File.class"path");
    private static final long PREFIX_LENGTH_OFFSET
            = UNSAFE.objectFieldOffset(File.class"prefixLength");

    /** use serialVersionUID from JDK 1.0.2 for interoperability */
    @java.io.Serial
    private static final long serialVersionUID = 301077366599181567L;

    // -- Integration with java.nio.file --

    private transient volatile Path filePath;

    /**
     * Returns a {@link Path java.nio.file.Path} object constructed from
     * this abstract path. The resulting {@code Path} is associated with the
     * {@link java.nio.file.FileSystems#getDefault default-filesystem}.
     *
     * <p> The first invocation of this method works as if invoking it were
     * equivalent to evaluating the expression:
     * <blockquote><pre>
     * {@link java.nio.file.FileSystems#getDefault FileSystems.getDefault}().{@link
     * java.nio.file.FileSystem#getPath getPath}(this.{@link #getPath getPath}());
     * </pre></blockquote>
     * Subsequent invocations of this method return the same {@code Path}.
     *
     * <p> If this abstract pathname is the empty abstract pathname then this
     * method returns a {@code Path} that may be used to access the current
     * user directory.
     *
     * @return  a {@code Path} constructed from this abstract path
     *
     * @throws  java.nio.file.InvalidPathException
     *          if a {@code Path} object cannot be constructed from the abstract
     *          path (see {@link java.nio.file.FileSystem#getPath FileSystem.getPath})
     *
     * @since   1.7
     * @see Path#toFile
     */

    public Path toPath() {
        Path result = filePath;
        if (result == null) {
            synchronized (this) {
                result = filePath;
                if (result == null) {
                    result = FileSystems.getDefault().getPath(path);
                    filePath = result;
                }
            }
        }
        return result;
    }
}

Messung V0.5 in Prozent
C=94 H=91 G=92

¤ Die Informationen auf dieser Webseite wurden nach bestem Wissen sorgfältig zusammengestellt. Es wird jedoch weder Vollständigkeit, noch Richtigkeit, noch Qualität der bereit gestellten Informationen zugesichert.0.132Bemerkung:  (vorverarbeitet am  2026-06-10) ¤

*Bot Zugriff






Wurzel

Suchen

PVS Prover

Isabelle Prover

NIST Cobol Testsuite

Cephes Mathematical Library

Vienna Development Method

Haftungshinweis

Die Informationen auf dieser Webseite wurden nach bestem Wissen sorgfältig zusammengestellt. Es wird jedoch weder Vollständigkeit, noch Richtigkeit, noch Qualität der bereit gestellten Informationen zugesichert.

Bemerkung:

Die farbliche Syntaxdarstellung und die Messung sind noch experimentell.