2004-12-19  Sven Neumann  <sven@gimp.org>

 * Made 2.2.0 release.

2004-12-18  Sven Neumann  <sven@gimp.org>

 * app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label.

2004-12-18  Sven Neumann  <sven@gimp.org>

 * app/dialogs/resize-dialog.c: free the dialog's private data
 struct using a weak reference, not in a "destroy" handler.  Should
 fix bug #161472.

 * app/dialogs/print-size-dialog.c
 * app/dialogs/scale-dialog.c: same change here.

2004-12-18  Sven Neumann  <sven@gimp.org>

 * app/dialogs/quit-dialog.c: marked a message for translation that
 had been forgotten. Fixes bug #161596.

2004-12-17  Sven Neumann  <sven@gimp.org>

 * autogen.sh: check for gtk-doc.m4, depend on intltool > 0.31.

2004-12-17  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't
 use the rect-select cursor if the tool is in move-layer mode.
 Spotted by Joao S. O. Bueno, bug #161465.

2004-12-17  Simon Budig  <simon@gimp.org>

 * app/tools/gimpcurvestool.c: Kill some nonsensical code that
 tried to set control points in a free form curve based on the
 image coordinates (huh?). Update the Graph after adding a point.
 Untabbified.

2004-12-17  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color):
 take drawable offsets into account. Fixes bug #161508.

2004-12-17  Sven Neumann  <sven@gimp.org>

 * docs/gimp-remote.1.in
 * docs/gimp.1.in
 * docs/gimptool.1.in: minor tweaks.

2004-12-17  Simon Budig  <simon@gimp.org>

 * data/images/gimp-splash.png: Added new splash by
 Bill Luhtala <bluhtala@telus.net>.

 * data/images/gimp-logo.png: Added new Image for the about dialog
 by Philip Lafleur <deathpudding@gmail.com>.

 * app/dialogs/about-dialog.c: Adjusted text colors and placement
 to the new image.

 * data/images/gimp2_0_logo.png
 * data/images/gimp2_0_splash.png: Added for historical reasons.

 * data/images/gimp_logo.png: Removed (renamed to gimp-logo.png)
 * data/images/Makefile.am: changed accordingly.

2004-12-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpgradient-load.c: reject .ggr files whose 
 segments don't properly span the range 0-1.
 Fixes bug #161430.
 
2004-12-16  Manish Singh  <yosh@gimp.org>

 * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast
 result of g_value_dup_object() to GIMP_CONTEXT().

2004-12-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/script-fu/scripts/circuit.scm: don't try to
 desaturate a grayscale layer, fixes bug #161470.

2004-12-16  Sven Neumann  <sven@gimp.org>

 * INSTALL: updated location of fontconfig sources.

2004-12-16  Sven Neumann  <sven@gimp.org>

 * app/config/gimpconfig-dump.c
 * docs/gimp-remote.1.in
 * docs/gimp.1.in
 * docs/gimprc.5.in: hyphens revisited.

2004-12-16  Sven Neumann  <neumann@jpk.com>

 * app/config/gimpconfig-dump.c (dump_gimprc_manpage): escape hyphens.

 * docs/gimp.1.in: documented the way that splash images are choosen.

 * docs/gimprc.5.in: regenerated.

2004-12-16  Michael Natterer  <mitch@gimp.org>

 * app/actions/actions.c (action_data_get_*): get gimp, display or
 image from a context only if it isn't NULL. Fixes warnings and
 crashes when dragging around some dockables (the dockables'
 context temporarily becomes NULL while dragging).

 Reordered checks for the passed "data" to be consistent across the
 various functions.

 Removed assertions which said "#warning: remove me before 2.2"

2004-12-16  Sven Neumann  <neumann@jpk.com>

 * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
 added a note on how to use the dialog, copied from the GNOME keyboard
 shortcuts editor.

2004-12-15  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/text_tool.pdb: let gimp_text() and
 gimp_text_fontname() succeed but return -1 if no layer was created.
 Fixes bug #161272.

 * app/pdb/text_tool_cmds.c
 * libgimp/gimptexttool_pdb.c: regenerated.

2004-12-15  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-preview.[ch]: added utility function
 gimp_drawable_preview_bytes() and use it. Some cleanup,
 untabified.

 * app/widgets/gimpviewrendererdrawable.c: use
 gimp_drawable_preview_bytes() instead of duplicating its code.

2004-12-15  Michael Natterer  <mitch@gimp.org>
     Sven Neumann  <sven@gimp.org>

 * app/core/gimpdrawable-preview.c (gimp_drawable_preview_scale):
 fixed RGBA resampling by using premultiplied values for the
 intermediate accumulation buffer. Fixes bugs #72880 and #72881.

2004-12-14  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-proc-frame.[ch]: added "gint ref_count" to
 the PlugInProcFrame struct. Added new functions
 plug_in_proc_frame_ref/unref().

 (plug_in_proc_frame_new): set the ref_count to 1.

 * app/plug-in/plug-in.[ch] (plug_in_proc_frame_push): return the
 new proc_frame.

 (plug_in_proc_frame_pop): use unref() instead of free().

 * app/plug-in/plug-in-run.c (plug_in_temp_run): ref the proc_frame
 while running its main loop. Removed the call to
 plug_in_proc_frame_pop().

 * app/plug-in/plug-in-message.c (plug_in_handle_temp_proc_return):
 call plug_in_proc_frame_pop() immediately after
 plug_in_main_loop_quit() so the proc_frame goes away from the
 stack and can't be used accidentially if the core is too busy to
 return to the main loop before the next command arrives on the
 wire. Really fixes bug #161114 this time.

2004-12-14  Simon Budig  <simon@gimp.org>

 * app/vectors/gimpstroke.[ch]: Changed the "gradient" parameter
 to "slope" to make it more clear what the returned result is (which
 was wrong earlier).
 * tools/pdbgen/pdb/paths.pdb: changed accordingly

 * app/pdb/paths_cmds.c
 * libgimp/gimppaths_pdb.[ch]: regenerated.

 Fixes bug #161274.

2004-12-14  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_selection.c: don't use 
 gtk_tree_selection_get_selected with GTK_SELECTION_MULTIPLE. Should
 finally fix bug #149157.

2004-12-14  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpstock.c (gimp_stock_init): documented.

2004-12-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_misc.c (make_toolbar_radio_icon): don't
 call gtk_radio_tool_button_new_with_stock_from_widget() with a
 NULL widget. Fixes bug #161210.

2004-12-14  Sven Neumann  <sven@gimp.org>

 * configure.in: added GIMP_API_VERSION to the generated gimpversion.h.

 * libgimpbase/gimpenv.c (gimp_toplevel_directory): use
 GIMP_API_VERSION instead of GIMP_MACRO_VERSION.GIMP_MINOR_VERSION
 when building a path to test the plug-in executable path against.

2004-12-14  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable.pdb: added gimp_drawable_sub_thumbnail()
 to enable plug-ins avoiding #142074-alike bugs if they need to.

 * app/pdb/drawable_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpdrawable_pdb.[ch]: regenerated.

 * libgimp/gimpdrawable.[ch]
 * libgimp/gimppixbuf.[ch]: wrap it with the same convenience
 APIs as gimp_drawable_thumbnail().

 * libgimp/gimp.def
 * libgimp/gimpui.def: changed accordingly.

2004-12-13  Sven Neumann  <sven@gimp.org>

 * HACKING
 * autogen.sh
 * configure.in: switched to using gtkdocize for the build of the
 API docs.

2004-12-13  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_selection.c: don't try do to anything when
 selection is empty. Fixes bug #149157.

2004-12-13  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_misc.[ch]
 * plug-ins/imagemap/imap_selection.[ch]
 * plug-ins/imagemap/imap_toolbar.[ch]
 * plug-ins/imagemap/imap_tools.[ch]: removed need for 
 GTK_DISABLE_DEPRECATED. Looking at #149157 next...

2004-12-13  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpcroptool.c: don't show the Crop tool window if
 Shift is being pressed on the initial button_press event.

2004-12-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/pygimp/gimpfu.py: display PF_RADIO options vertically
 instead of horizontally, as suggested by Joao S. O. Bueno Calligaris.
 Fixes bug #160546.
 
2004-12-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig.c: make the "gfig" layer parasites persistent,
 so that they will be saved in xcf files.  Stop printing "GFig
 parasite found" message.
 
2004-12-13  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppdbdialog.[ch]: don't forget the context we
 were created with but rmember it as pdb_dialog->caller_context.

 * app/widgets/gimpbrushselect.c
 * app/widgets/gimpfontselect.c
 * app/widgets/gimpgradientselect.c
 * app/widgets/gimppaletteselect.c
 * app/widgets/gimppatternselect.c: use the caller_context when
 calling the temp_proc so the temp_proc's stack frame doesn't
 contain the dialog's private context (which is just a scratch
 model for the container views) but the plug-in's real context
 which is fully initialized. Fixes bug #161114.

2004-12-13  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablecombobox.c: fixed gtk-doc comment.

2004-12-13  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-style.c: let objects keep their own fill_style
 context.

2004-12-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimage-convert.c: applied patch from Adam D. Moss with
 more fixed dither improvements (bug #161123).

2004-12-13  Sven Neumann  <sven@gimp.org>

 * app/gui/splash.c: restrict splash image to screen size to guard us
 from insanely large splash images.

2004-12-13  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so
 everything except GTK_RESPONSE_OK keeps the dock open
 (e.g. hitting escape).

2004-12-12  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview):
 added precondition check for the coords of the src area. Some
 cleanup and simplification.

 * app/widgets/gimpviewrendererdrawable.c
 (gimp_view_renderer_drawable_render): don't request sub-previews
 of area outside the drawable and don't reuqest previews of zero
 width or height. Fixes crashes with the new preview code.

2004-12-12  Sven Neumann  <sven@gimp.org>

 Applied patch from Adam D. Moss (bug #161113):
 
 * app/core/gimpimage-convert.c: Use a slower but much nicer
 technique for finding the two best colours to dither between when
 using fixed/positional dither methods.  Makes positional dither
 much less lame.

2004-12-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/film.c (film): push a context around code that
 changes the foreground color.

2004-12-12  Sven Neumann  <sven@gimp.org>

 * app/batch.c (batch_run): changed handling of the 'gimp -b -'
 command-line. It used to spawn three instances of Script-Fu, two
 should be more than enough.

2004-12-12  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/widgets/gimpdataeditor.c: make Revert button insensitive
 because revert is not yet implemented (bug #152259).
 
2004-12-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpdock.c: show a confirmation dialog if a dock
 with multiple tabs is being closed. Sorry for the new strings,
 they were carefully copied from gnome-terminal.

2004-12-12  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/pnm.c: make export do the right thing when
 saving as .pgm or .ppm.  Fixes bug #160045.
 
2004-12-12  Sven Neumann  <sven@gimp.org>

 * libgimp/gimp.def: added gimp_edit_copy_visible.

 * plug-ins/script-fu/scripts/copy-visible.scm: deprecated.

2004-12-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/winclipboard.c: applied patch from Brion Vibber
 that adds an alpha channel to the pasted layer. Fixes bug #148601.

2004-12-12  Sven Neumann  <sven@gimp.org>

 * app/base/tile-manager-crop.c: removed trailing whitespace.

 * plug-ins/imagemap/imap_selection.c: need to define
 GTK_DISABLE_DEPRECATED for gtk_toolbar_append_space().

2004-12-12  Michael Natterer  <mitch@gimp.org>

 * app/paint-funcs/paint-funcs.[ch]: added new function
 copy_region_nocow() as a workaround for the fact that sharing
 tiles with the projection is heavily broken.

 * app/base/tile-manager.c (tile_invalidate): added a warning when
 entering the code path that breaks badly.

 * app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using
 the non-COW copying function above.

 * app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE.

 * app/actions/edit-actions.c
 * app/actions/edit-commands.[ch]: added action & callback for
 "edit-copy-visible".

 * menus/image-menu.xml.in: added "edit-copy-visible" to the image
 menu.

 * tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible()
 PDB wrapper.

 * app/pdb/edit_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpedit_pdb.[ch]: regenerated.

 * plug-ins/script-fu/scripts/copy-visible.scm: removed all code
 and made it a backward compat wrapper around gimp-edit-copy-visible.
 Fixes bug #138662.

2004-12-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-preview.c (gimp_drawable_preview_private):
 implement it using gimp_drawable_get_sub_preview(). Removes
 massive code duplication introduced by yesterday's fix.

2004-12-11  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/copy-visible.scm: Apply the layer mask
 when copying a single layer with a layer mask. Fixes bug #138662.

 * plug-ins/script-fu/scripts/t-o-p-logo.scm: Removed ' character.

2004-12-11  Sven Neumann  <sven@gimp.org>

 * INSTALL
 * NEWS
 * README: updates for the GIMP 2.2.0 release.

2004-12-11  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/unsharp.c: got rid of a global variable.

 * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): more changes
 to restore the gimp-2.0 behaviour.

2004-12-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-preview.[ch]: added new function
 gimp_drawable_get_sub_preview() which returns a scaled preview of
 a part of a drawable.

 (gimp_drawable_preview_scale): made it work with srcPR.x and
 srcPR.y being != 0.

 * app/core/gimpimage-preview.c (gimp_image_get_new_preview)
 * app/widgets/gimpviewrendererdrawable.c
 (gimp_view_renderer_drawable_render): if the area of the drawable
 preview is more than 4 times larger than the drawable itself (evil
 heuristic, but seems to work fine), use above function to get a
 sub-preview of the drawable instead of getting an insanely large
 preview of the whole drawable just to use a small part of it.
 Fixes bug #142074.

 * app/core/gimpimage-preview.c (gimp_image_get_new_preview):
 optimized by skipping layers which do not intersect with the
 canvas.

2004-12-11  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): do actually
 change the bumpmap drawable. Fixes bug #160985, hopefully without
 reopening bug #158494.

2004-12-11  Sven Neumann  <sven@gimp.org>

 * configure.in: set version to 2.2.0.

 * tools/Makefile.am
 * tools/authorsgen/Makefile.am
 * tools/authorsgen/authorsgen.pl
 * tools/authorsgen/contributors: removed authorsgen, a perl script
 that used to be used to create AUTHORS and authors.h.

 * Makefile.am
 * authors.dtd
 * authors.xml: added a simple XML file that lists authors and
 contributors and a DTD to validate it.

 * authors.xsl: a stylesheet to generate AUTHORS from authors.xml.

 * app/dialogs/Makefile.am
 * app/dialogs/authors.xsl: a stylesheet to generate authors.h from
 authors.xml.

 * app/dialogs/authors.h: regenerated.

 * app/dialogs/about-dialog.c: added a const modifier.

2004-12-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/widgets/gimphistogrameditor.c: make histogram editor,
 and therefore histogram dialog, use the selection.  Should
 resolve bug #72959.

 * app/core/gimpdrawable-histogram.h: remove trailing whitespace.
 
2004-12-10  Manish Singh  <yosh@gimp.org>

 * app/widgets/gimpdatafactoryview.c
 * app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp()

2004-12-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdatafactoryview.c
 (gimp_data_factory_view_tree_name_edited)
 * app/widgets/gimpitemtreeview.c
 (gimp_item_tree_view_name_edited)
 * app/widgets/gimptemplateview.c
 (gimp_template_view_tree_name_edited): call gimp_object_set_name()
 or gimp_item_rename() only if the item's name has actually changed
 and restore the old text otherwise. Fixes one instance of "name is
 not updated correctly after editing" for which I blamed GTK+ in
 bug #145463 :-) The other instances should be fixed in GTK+ HEAD
 and are imho unfixable with GTK+ 2.4.

2004-12-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainertreeview.c
 (gimp_container_tree_view_clear_items): clear all viewable cell
 renderers so they don't keep pointers to layers/masks which don't
 exist any more. Fixes the additional problem in bug #148852 but
 not the bug itself.

2004-12-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpbrushpipe.c (gimp_brush_pipe_select_brush):
 Don't initialize a new random number generator every time a brush
 is selected from a pipe.  Fixes bug #148205).
 
2004-12-09  DindinX  <dindinx@gimp.org>

 * plug-ins/common/cartoon.c: marked the menu entry for translation
 (reported by Zigomar)

2004-12-09  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/print-size-dialog.c
 * app/widgets/gimpsizebox.c: set a focus_chain on the size_entries
 so the focus order is width->height->chain->unitmenu and not
 width->chain->height->unitmenu.

 * app/widgets/gimptemplateeditor.c: changed focus_chain code to
 work like above (cosmetics).

2004-12-09  Sven Neumann  <sven@gimp.org>

 * app/gui/splash.c (splash_update): only expose the area of the
 window that actually changed.

 * app/plug-in/plug-in-rc.c (plug_in_rc_write): changed the header
 and footer to be more in line with the other rc files.

2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
 Previous fix only worked if units were inches -- now seems to
 work for all units. (fixes #159273 ?)

2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/randomize.c:  Changed algorithm for Pick and
 Slur to treat all channels within a pixel in the same way;
 intended to fix bug #72852.
 
2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
 fixed kludgy use of size entry, seems to fix bug #159273.

2004-12-08  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpuimanager.[ch]: renamed
 gimp_ui_manager_get_action() to gimp_ui_manager_find_action().

 * app/widgets/gimpcolormapeditor.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimppaletteeditor.c
 * app/widgets/gimptoolbox.c
 * app/widgets/gimptooloptionseditor.c
 * app/display/gimpdisplayshell-close.c: changed accordingly.

 (this change is quite useless as it stands, but will help keeping
 the diff between 2.2 and 2.3 small as soon as we're branched).

 * app/widgets/gimpcolormapeditor.c
 (gimp_colormap_preview_button_press): invoke the "edit-color", not
 "new-color" action upon double click.

 (palette_editor_select_entry): update the ui manager after
 selecting the entry so the entry-specific actions become sensitive
 if there was no entry selected before.

2004-12-08  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppropwidgets.[ch]: added new prop_widget
 gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore
 and allows to create views on int properties with arbitrary sets
 of values (not just enums).

 * app/widgets/gimpcontrollereditor.c
 (gimp_controller_editor_constructor): added support for generic
 combo boxes controlled exclusively by controller properties: if an
 int property "foo" is followed by an object property "foo-values"
 and the contained object is a GimpIntStore, use that store as
 model for selecting "foo"'s values using
 gimp_prop_int_combo_box_new().

 (Allows for more flexible controller configuration, the actual use
 case in the midi controller is still work in progress).

2004-12-06  Sven Neumann  <sven@gimp.org>

 * tools/authorsgen/contributors: removed duplicate entry for Roman.

 * AUTHORS
 * app/dialogs/authors.h: regenerated.

2004-12-06  Roman Joost <romanofski@gimp.org>

 * tools/authorsgen/contributors: added Róman Joost to
 contributors

2004-12-06  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptransformtool.c: applied patch from Sven Neumann
 which removes code that prevents layers with mask from being
 transformed.

 * app/tools/gimptransformtool.[ch]: added "gboolean mask_empty"
 parameter to GimpTransformTool::transform(). Needed because the
 selection gets cleared by cutting from the drawable and we need
 the selection's state before that cutting.

 (gimp_transform_tool_doit): pass "mask_empty" to
 GimpTransformTool::transform():

 * app/tools/gimptransformtool.c (gimp_transform_tool_real_transform)
 * app/tools/gimpfliptool.c (gimp_flip_tool_transform): when
 transforming a layer with mask and there is no selection,
 transform the mask just as if it was a linked item.
 Fixes bug #143837 and bug #159697.

2004-12-05  Sven Neumann  <sven@gimp.org>

 * app/core/gimp-transform-utils.c (gimp_transform_matrix_flip_free):
 applied patch from Joao S. O. Bueno that fixes bug #160339.

2004-12-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/help/domain.c
 * plug-ins/help/gimp-help-lookup.c
 * plug-ins/help/help.[ch]: if the help files are not installed,
 uninstall the temporary procedure and quit. Fixes bug #160258.

2004-12-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/lic.c: applied patch from Joao S. O. Bueno that
 sets a lower limit for the filter length (bug #160121). The patch
 also makes the plug-in work on drawables with alpha channel.

2004-12-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/wmf.c: applied patch from Karine Proot that
 limits the size of the preview in the WMF loader (bug #133521).

2004-12-04  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-arc.h
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-bezier.h
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-circle.h
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-dobject.h
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-ellipse.h
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-line.h
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-poly.h
 * plug-ins/gfig/gfig-preview.c
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-spiral.h
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig-star.h: updating a object is now a virtual
 function.

2004-12-03  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage-undo-push.c (undo_pop_layer): when removing
 the floating selection, call gimp_drawable_invalidate_boundary()
 *before* setting gimage->floating_sel to NULL because otherwise
 gimp_display_shell_selection_invis() won't clear the correct
 selection bounds and leave garbage on screen. Fixes bug #160247.

2004-12-02  Michael Natterer  <mitch@gimp.org>

 * app/actions/tool-options-actions.c
 (tool_options_actions_update_presets): don't forget to initialize
 the "value_variable" boolean of GimpEnumActionEntry. Fixes myriads
 of warnings about wrong values for boolean properties.

 * app/actions/file-actions.c (file_actions_setup): same
 here. Fixes nothing but is cleaner.

2004-12-02  Simon Budig  <simon@gimp.org>

 * app/vectors/gimpvectors.c: Fixed stupid typo that caused
 distorted vectors on scaling after resizing. Spotted by
 Joao S. O. Bueno.

 Fixes bug #157852.

2004-12-01  Sven Neumann  <sven@gimp.org>

 * autogen.sh: rephrased the warning that is shown when the
 intltool check fails.

2004-12-01  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved
 error message about missing XML files.

2004-12-01  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-appearance.c
 * app/display/gimpdisplayshell.c
 * app/widgets/gimpdockable.c
 * app/widgets/gimptexteditor.c
 * app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
 actually returns something. Prevents crashes caused by missing
 ui manager xml files. Fixes bug #159346.

2004-12-01  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need
 to update the ui manager here, the parent class already does it.

2004-11-30  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/README: removed some very obsolete stuff.

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-arc.h
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-bezier.h
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-circle.h
 * plug-ins/gfig/gfig-dobject.c: small cleanups

2004-11-30  Michael Natterer  <mitch@gimp.org>

 * app/gui/themes.c (themes_init): use gtk_rc_parse() instead of
 gtk_rc_add_default_file() to add ~/.gimp-2.2/themerc to the list
 of files parsed by GTK+ because the latter works only before
 gtk_init(). Fixes bug #155963.

2004-11-30  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/print-size-dialog.c: reordered prototypes to match
 order of implementations.

2004-11-30  Sven Neumann  <sven@gimp.org>

 * app/sanity.c: we check for the same version of freetype on all
 platforms, no need for an ifdef here.

2004-11-30  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpexport.c: some more HIG-ification tweaks to the
 Export dialogs.

2004-11-30  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpactiongroup.c
 (gimp_action_group_set_action_color)
 (gimp_action_group_set_action_color): allow to set color and
 viewable to NULL, GimpAction handles this nicely. Fixes warnings
 some foo_actions_update() functions were triggering.

2004-11-30  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/*[ch]: code cleanup

2004-11-29  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/display.pdb: make it work as documented (fail
 if the new_image already has a display). Also fail if the
 old_image doesn't have any display (changed docs accordingly).
 On success, take over the initial reference count of the new
 image, just as the gimp_display_new() PDB wrapper does.
 Fixes bug #159051.

 * app/pdb/display_cmds.c
 * libgimp/gimpdisplay_pdb.c: regenerated.

2004-11-29  Sven Neumann  <sven@gimp.org>

 * app/file/file-save.c (file_save_as): when the image filename
 changes, forget the filename that was last used with "save-a-copy".

2004-11-29  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
 change the "update" property and notify listeners (in particular
 GimpDrawablePreview) before invalidating the preview. Plug-ins
 might (needlessly) look at the property to decide whether they
 need to redraw. Fixes bug #159816.

 * plug-ins/common/unsharp.c (preview_update): no need to look at
 the value of the "Preview" toggle. GimpPreview takes care this.

2004-11-29  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: issue a repaint after the
 "show previous", "show next" and "show all" callbacks.

 * plug-ins/gfig/gfig-style.c: fixed some comments.

2004-11-29  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_preview.c
 * plug-ins/imagemap/imap_selection.c: undeprecated.

2004-11-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dobject.c: copy the style of the object when
 pushing it to the undo stack, so undoing works as expected.

2004-11-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-style.c
 * plug-ins/gfig/gfig-style.h: create a new function to get the current
 style instead of using a global pointer for this
 (gfig_context_get_current_style ())

 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig.h: use this function everywhere it is needed. And
 remove the current_style field from GfigContext.

 (unrelated):
 * plug-ins/FractalExplorer/Dialogs.h
 * plug-ins/FractalExplorer/FractalExplorer.c: small cleanups

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-style.[ch]
 * plug-ins/gfig/gfig.h: removed unused stack of styles. Removed
 gimp_style from GFigContext.

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig.c (run): push a context for GFig.

2004-11-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.[ch]
 * plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level.
 Fixed the style handling when clearing the whole thing and undoing in
 some very particular cases. The undo part should certainly be redone
 to some extent.

 Btw, this is the revision 1.10000 of the ChangeLog, yeah!

2004-11-28  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig-style.c: make sure PaintType is saved and
 loaded with the style.
 
2004-11-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type
 field of the default style.

 * plug-ins/gfig/gfig-style.c: don't print an useless error message
 where no-one can see it when loading an other with no style but use
 the default style instead.

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.[ch]
 * plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit
 menu.  Added a utility function to set the sensitivity of an action
 by name. Cleaned up action callbacks.

 * plug-ins/gfig/gfig-style.c: minor cleanup.

2004-11-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-star.c: made the class name uppercase since it is
 used to parse a gfig file.

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid
 and Preferences dialogs are only accessed while the dialogs exist.

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences
 dialogs singletons and declared them as transient to the GFig
 window. Don't let them run their own main loop.

2004-11-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: added a Close menu item to the
 menubar. Removed help buttons from popup dialogs. Set the same
 default directory in load and save filechoosers.

2004-11-27  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to
 avoid perl trying to be so smart that it's stupid.

 * app/pdb/drawable_transform_cmds.c: regenerated.

2004-11-27  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/jpeg.c (save_image): thumbnail buffer variable
 declarations should be guarded under HAVE_EXIF.

2004-11-27  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/,
 so it doesn't clash with the perl version.

 * plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change.

2004-11-27  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c: delay the creation of the display for
 the export image preview until the user requests a preview. Fixes
 bug #159376.

2004-11-27  Øyvind Kolås  <pippin@gimp.org>

 * libgimp/gimpexport.c: minor layout adjustments for HIG compliance.

2004-11-27  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth
 to be integer values. Changed default for Outer teeth to give a
 more interesting image. Detabified file. Fixes bug #158448. 

2004-11-27  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
 don't look at the menu path to determine if the script is
 image-based. Instead look at the number of parameters we are being
 called with.

2004-11-27  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
 as suggested in bug #159632.

2004-11-27  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tiff.c (save_image): tell the user that we can't
 handle indexed images with alpha channel (bug #159600).

2004-11-27  Sven Neumann  <sven@gimp.org>

 * app/main.c
 * app/widgets/gimpenumstore.h
 * app/widgets/gimpunitstore.c
 * plug-ins/common/retinex.c: applied patch by Tim Mooney that
 removes extraneous ;

2004-11-27  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/wmf.c (run): applied patch by Tim Mooney that
 increase the size of values[] to accomodate the use of
 file_wmf_load_thumb (bug #159601).

2004-11-27  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs.

 * libgimp/gimpdrawable_pdb.c
 * tools/pdbgen/pdb/drawable.pdb: regenerated.

2004-11-27  Sven Neumann  <sven@gimp.org>

 * plug-ins/winicon/icosave.c
 * plug-ins/winicon/main.[ch]: moved code around.

2004-11-26  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/dog.c: make sure the preview image type matches
 the source image type.

2004-11-26  Sven Neumann  <sven@gimp.org>

 * plug-ins/winicon/icosave.c: don't fiddle with the source image,
 a save plug-in should save, nothing else.

 * plug-ins/winicon/main.[ch]: handle all sorts of image types.
 Fixes bug #157803.

2004-11-26  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/drawable.pdb: fixed docs for
 gimp_drawable_type_with_alpha().

 * app/pdb/drawable_cmds.c
 * libgimp/gimpdrawable_pdb.c: regenerated.

2004-11-26  Sven Neumann  <sven@gimp.org>

 * plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf)
 * plug-ins/winicon/icodialog.c
 * plug-ins/winicon/icoload.c
 * plug-ins/winicon/icosave.c: fixed drawable handling. This
 plug-in is still a complete mess and needs a lot more work.

2004-11-26  Sven Neumann  <sven@gimp.org>

 * app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
 show the Incremental toggle for tools that use it (bug #159306).

2004-11-26  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdocumentlist.c (gimp_document_list_deserialize):
 don't add documents w/o a name to the list. Fixes bug #159510.

 * app/core/gimpdrawable.c (gimp_drawable_resize): extended the
 check to take the offsets into account as well.

2004-11-25  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/dog.c: Add the temporary layers to the image, so
 things work. Fixes bug #158895.

 * plug-ins/common/iwarp.c: Fix same naughtiness as above. There's
 other naughtiness still though.

 * plug-ins/common/sunras.c: use gboolean for byte2bit invert argument.

2004-11-25  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within
 PreviewPersistent, instead of an automatic variable in save_image.
 Fixes bug #159076.

2004-11-25  Simon Budig  <simon@gimp.org>

 * modules/controller_linux_input.c: Add some sample code to retrieve
 the name of the connected MIDI device (ALSA).
 Do not set the "name" when connected to Alsa, since snd_seq_name()
 returns an uninteresting name.

2004-11-24  Michael Natterer  <mitch@gimp.org>

 * app/gui/gui.c (gui_display_changed): if the active display
 becomes NULL (e.g. by closing a view), don't leave the user
 context with an image but no display. Instead, try to find another
 display of the same image and if that fails set the image to NULL.

 Prevents the various foo_actions_update() functions from being
 called with a NULL display while there is still an active image in
 the context.

 Fixes bug #159304.

 (Removed #warning about being misplaced from that function because
 it's a typical piece of ugly glue code that belongs exactly here).

2004-11-24  Simon Budig  <simon@gimp.org>

 * modules/controller_linux_input.c: Accept >= 0 return values of the
 ioctl() to figure out the device name. Apparently it is the number of
 bytes written to the string, so we might omit the strlen() following,
 but I don't like to rely on that...

2004-11-24  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
 with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
 fixed API yet. Added a "state" property bacause "name" was abused
 as the controller's state. Added "help_domain" to the controller
 class.

 * libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h

 * modules/controller_linux_input.c
 * modules/controller_midi.c: set the "name" property to the name
 retrieved from the device, or to a default string if no name is
 available. Store the status in the "state" property. Added and
 changed some strings, but it's better to have the controller
 strings untranslated than to have no tooltips at all or misleading
 labels.

 * app/widgets/gimpcontrollerkeyboard.c
 * app/widgets/gimpcontrollerwheel.c: set default strings for both.

 * app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
 property.

 * app/widgets/gimpcontrollerkeyboard.h
 * app/widgets/gimpcontrollerwheel.h
 * app/widgets/gimpcontrollerinfo.c
 * app/widgets/gimpcontrollers.c: #define
 GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
 above).

 * app/widgets/gimphelp-ids.h: added the IDs of all controller
 modules and also of all other modules. The defines are not
 actually used, but this file is the canonical place to collect all
 the core's help IDs.

2004-11-23  Sven Neumann  <sven@gimp.org>

 * app/core/gimp-templates.[ch]
 * app/dialogs/user-install-dialog.c: merge the migrated user
 templaterc with the system templaterc so the users who have used
 gimp-2.0 before get our changes to the default templates.

2004-11-23  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpwidgets-utils.[ch]: added new function
 gimp_toggle_button_set_visible() which can be used as "toggled"
 callback on a GtkToggleButton and sets a widget (in)visible
 according to the toggle's "active" state.

 * app/tools/gimpblendoptions.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimpselectionoptions.c: use it to hide (rather than
 just insensitize) the seldomly used "Feather edges", "Autoshrink
 selection", "Adaptive supersampling", "Fade out" and "Use color
 from gradient" widgets when their enabling toggle is unchecked.
 Makes the affected tool options much less crowded and noisy in
 their default appearance. Fixes bug #159008.

2004-11-23  Michael Natterer  <mitch@gimp.org>

 * app/menus/plug-in-menus.c (plug_in_menus_add_proc): create
 dynamic sub-menus using a separate, ui-manager-global merge_id
 instead of the procedure's merge_id. Has the effect that the ui
 manager keeps around these sub-menus forever, even if the
 procedure that initially registered them is unregistered.
 Fixes menu ordering after Script-Fu->Refresh.

2004-11-23  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpparasitelist.c: cosmetics, untabified.

 * libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s
 to all functions. 

 (gimp_pixpipe_params_parse): changed "gchar*" param to "const
 gchar*" (sortof API change, but these files are most probably only
 used by GIMP itself). Still uses strtok() on the internal copy,
 but at least not on the passed string.

 * plug-ins/common/csource.c
 * plug-ins/common/gif.c
 * plug-ins/common/gih.c
 * plug-ins/common/jpeg.c
 * plug-ins/common/png.c
 * plug-ins/common/tiff.c: use parasite getters instead of
 accessing the scruct members directly. Always use g_strndup()
 instead of just g_strdup() to get strings stored in parasites
 because there is no guarantee that they are nul-terminated.

2004-11-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do
 actually use a save dialog here. Fixes bug #159194.

2004-11-23  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if
 the size doesn't change. This keeps text layers from being
 modified when an image is cropped and the layer is entirely inside
 the cropped area.

 * menus/image-menu.xml.in: put the Quit item back for now. We
 should think about this again in the next development cycle.

2004-11-22  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect
 comparison in if statement. Partial(?) fix for bug #138662. 

2004-11-22  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/Makefile.am
 * plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears.

 * plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout
 tweaks.

2004-11-22  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
 always create the event mapping table. Fixes tons of warnings and
 non-functional controller mapping dialog when an empty controller
 was deserialized from controllerrc. Spotted by drc.

2004-11-22  Sven Neumann  <sven@gimp.org>

 * app/app_procs.c (app_exit_after_callback): call base_exit()
 before quitting the application using exit(). Fixes bug #159019.

 * app/base/tile-swap.c: moved the warning about a non-empty swap
 file into #ifdef GIMP_UNSTABLE ... #endif.

2004-11-22  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising
 check box.  Reported by Zigomar.

2004-11-22  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs
 by their menu_paths *and* the procedure's menu_labels. Fixes menu
 item sorting after "Refresh".

2004-11-22  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
 added a "menu_factory" parameter instead of trying to get it from
 the toplevel GimpDock (which does not exists if the tool options
 dialog does not exist). Fixes bug #159071.

 * app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
 menu_factory.

 * app/dialogs/dialogs.c (dialogs_init): pass the global menu
 factory also when constructing the "toplevel" dialog factory so
 the above works.

2004-11-22  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup()
 instead of g_strdup() if a length was passed.

 * app/dialogs/info-window.c: g_strndup() the comment parasite's
 data and pass -1 as length to gimp_any_to_utf8() so we don't
 encounter the questionable (buggy?) behavior of g_utf8_validate()
 to fail upon finding '\0' within the "length" passed.
 Fixes bug #159051.

2004-11-22  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/struc.c: applied patch from Wolfgang Hofer
 which makes the plug-in use its procedure name for
 storing the "last_vals" struct. Fixes bug #159028.

 * plug-ins/common/tileit.c: ditto. Fixes bug #159029.

2004-11-22  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines
 half-selected.

2004-11-22  Sven Neumann  <sven@gimp.org>

 * app/dialogs/file-open-location-dialog.c: changed border-size of
 GimpContainerEntry to 0.

2004-11-21  Sven Neumann  <sven@gimp.org>

 * tools/gimp-remote.c: added --no-splash command-line option that
 is passed to gimp. Addresses Debian bug report #277989.

 * docs/gimp-remote.1.in: document the new option.

2004-11-21  Manish Singh  <yosh@gimp.org>

 * configure.in: reverted previous change, as not all the lv.pos are
 in CVS yet.

2004-11-21  Peteris Krisjanis  <pecisk@gmail.com>

 * configure.in: Added Latvian (lv) language support to ALL_LINGUAS.

2004-11-21  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM
 which makes the script work layers that have their top-left corner
 at a position other than the top-left corner of the image.
 Fixes bug #158863.

2004-11-21  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig.h: makes which object is selected more obvious by
 using filled handles for the selected object.  Not perfect, but
 certainly a good hint.

2004-11-21  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the
 realize callback of the preview, so the gray gc of the grid works
 again. Reported by Zigomar.

 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-preview.h
 * plug-ins/gfig/gfig-spiral.h
 * plug-ins/gfig/gfig-star.h
 * plug-ins/gfig/notes.txt: small cosmetics fixes.

2004-11-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/compose.c
 * plug-ins/common/decompose.c: transfer the image resolution to
 newly created images.

2004-11-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change
 that Hans Breuer committed here, probably accidentally.

 * plug-ins/script-fu/script-fu.c
 * plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There
 is indeed a Script-Fu server on Win32.

2004-11-21  Sven Neumann  <sven@gimp.org>

 * menus/image-menu.xml.in: removed "Quit" from the image menu.

2004-09-21  Hans Breuer  <hans@breuer.org>

 * app/dialogs/makefile.msc : [new file]
   app/dialogs/Makefile.am : added to EXTRA_DIST

 * **/makefile.msc app/gimpcore.def : updated

 * app/gimp.rc : let wilber be first

 * app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

 * libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

 * libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

 * plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

 * plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c :
 there is no script-fu-server on win32

2004-11-21  Michael Schumacher <schumaml@cvs.gnome.org>

 * plug-ins/script-fu/scripts/addborder.scm: first resize the
 image, then add the border layer and then fill it

2004-11-20  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in
 script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's.

2004-11-20  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c: renamed variable
 "script_list" to "script_tree" because it's a GTree.

 (script_fu_remove_script): g_list_free() the right list (don't
 leak all lists of scripts at the tree leaves).

2004-11-20  Sven Neumann  <sven@gimp.org>

 * Made 2.2-pre2 release.

2004-11-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/glob.c: added an (optional) parameter that
 allows to request the output in the filesystem encoding.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare):
 compare the menu paths, not the struct pointers.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/glob.c: added a naive glob() implementation
 which handles the most common use case and is certainly better
 than nothing. Closes bug #143661 again.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * libgimp/gimp.c: converted a g_warning() to g_printerr().

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/xpm.c: just some minor code cleanup.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a
 single one.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/noisify.c: applied a (modified) patch that adds
 the possibility to correlate the noise with the signal. Adds the
 new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700.

 * plug-ins/helpbrowser/dialog.c: set a reasonable default size.

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of
 fread(). Unfortunately this slowed down the plug-in again.
 Disabled the code that reads the pipe to the end. This brings it
 back to speed. Seems to work fine for me, let's see if this causes
 problems for anyone...

2004-11-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: moved into the
 <Image>/Select/Modify menu now that we can safely use placeholders
 from Script-Fu.

2004-11-19  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/lib.pl
 * tools/pdbgen/stddefs.pdb: added support for deprecated procedures
 without any replacement.

 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added
 a special warning for procedures without replacement.

 * tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image()
 without any replacement and made it a nop (which fails if the
 passed image is different from the drawable's image). It's not
 needed any longer since 2.0 and moreover dangerous to use.

 * app/pdb/drawable_cmds.c
 * libgimp/gimpdrawable_pdb.[ch]: regenerated.

 * app/core/gimpitem.c (gimp_item_set_image): replaced assertion
 for gimp_item_is_floating() by !gimp_item_is_attached(). The
 former warned when adding a layer with already added mask to the
 image (which is a perfectly valid operation).

2004-11-18  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/wmf.c: added a thumbnail load procedure
 (bug #158193).

2004-11-18  Michael Natterer  <mitch@gimp.org>

 Script-Fu string cleanup/simplification: apply the same fix for
 menu path translation that was done for plug-ins a while ago.

 * plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use
 gimp_plugin_menu_register() on the "Refresh" temp_proc.

 * plug-ins/script-fu/scripts/*.scm: ported all scripts to use
 script-fu-menu-register and pass just the menu label in
 script-fu-register. Cleaned up all register calls to share a
 somewhat similar formatting.

2004-11-18  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c: changed the default to load only
 the first page of the document and added a tooltip describing how
 to specify what pages to get.

2004-11-18  Sven Neumann  <sven@gimp.org>

 * app/file/file-open.c (file_open_thumbnail): fixed check for
 number of return values.

2004-11-18  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c: speed up loading of multi-page
 documents significantly by skipping in large chunks instead of using
 fgetc() to crawl through the stream.

2004-11-18  Sven Neumann  <sven@gimp.org>

 * app/file/file-open.c (file_open_thumbnail): check the number of
 return values. Only retrieve width and height if the thumbnail
 load procedure does actually provide this information.

 * plug-ins/common/postscript.c: added a procedure to load a
 thumbnail.  For now it only renders the first page of the
 document at low resolution. It should be extended to load an
 embedded thumbnail if one is available.

 * plug-ins/common/jpeg.c
 * plug-ins/common/svg.c: no need to register a menu label for the
 thumbnail loaders. Allocate the return_vals array large enough to
 hold all return values.

2004-11-18  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpenumaction.[ch]: added boolean property
 "value-variable" which specifies if the GimpEnumAction::selected()
 signal may be emitted with arbirtary values (value-variable = TRUE)
 or *only* with enum_action->value (value-variable = FALSE).

 * app/widgets/gimpactiongroup.[ch]: added "gboolean
 value_variable" to GimpEnumActionEntry and set it in
 gimp_action_group_add_enum_actions().

 * app/actions/channels-actions.c
 * app/actions/colormap-editor-actions.c
 * app/actions/context-actions.c
 * app/actions/drawable-actions.c
 * app/actions/edit-actions.c
 * app/actions/error-console-actions.c
 * app/actions/gradient-editor-actions.c
 * app/actions/image-actions.c
 * app/actions/layers-actions.c
 * app/actions/palette-editor-actions.c
 * app/actions/plug-in-actions.c
 * app/actions/vectors-actions.c
 * app/actions/view-actions.c: set "variable" to FALSE for all enum
 actions except those which are used with the GIMP_ACTION_SELECT_SET
 voodoo.

 * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
 fall back to gtk_action_activate() if the action specified in a
 GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
 triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
 (like midi note-on and note-off).

2004-11-18  Michael Natterer  <mitch@gimp.org>

 * acinclude.m4: pasted the complete alsa.m4 so compiling from
 CVS doesn't require alsa.m4 to be installed.

 * configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA
 if found.

 * modules/Makefile.am: build controller_midi with ALSA_CFLAGS
 and ALSA_LIBS.

 * modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/.

2004-11-18  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/compressor.c (compressors): added back the
 .xcf.gz and .xcf.bz2 extensions because they are the only way
 to figure the special nature of this plug-in's extensions.

 * app/widgets/gimpfileprocview.[ch]: keep a list of "meta
 extensions" (extensions which have a '.' themselves).

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
 try to replace the whole extension if the last extension is one of
 the meta extensions kept by GimpFileProcView. Fixes bug #158377.

2004-11-18  Sven Neumann  <sven@gimp.org>

 * plug-ins/maze/maze.[ch]
 * plug-ins/maze/maze_face.c: removed the extra help button from
 the Maze plug-in. Fixes bug #158605.

2004-11-18  Michael Natterer  <mitch@gimp.org>

 The following fixes have no visible effect because nobody
 uses gimp_plugin_menu_register() on temp_procs yet:

 * app/actions/plug-in-actions.[ch]: added
 plug_in_actions_add_path() which just adds the actions needed for
 a given menu math, but not the procedure action itself.

 * app/gui/gui-vtable.c (gui_menus_create_entry): create the
 menu_path's actions using above function so adding of submenus to
 existing ui managers works.

 * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker):
 don't add a menu if "no_interface" is TRUE.

 * app/pdb/plug_in_cmds.c: regenerated.

 * plug-ins/script-fu/script-fu-scripts.c: pass untranslated
 menu_paths to the core, not translated ones. Don't store the
 scripts directly in the "script_list" tree but use a list of
 scripts per key because there can be identical keys for different
 scripts now. Fixed sorting of menu entries and menus.

2004-11-18  Simon Budig  <simon@gimp.org>

 * modules/controller_midi.c: implemented support for ALSA-midi,
 currently disabled. Needs a configure-check and proper linking
 against libasound.

2004-11-17  Dave Neary  <bolsh@gimp.org>

 * plug-ins/common/bumpmap.c: Fixed initialisation issue
 that was crashing the plug-in on repeat runs. Fixes bug
 #158494.

2004-11-17  Sven Neumann  <sven@gimp.org>

 * app/dialogs/print-size-dialog.c: added missing callbacks for the
 size entries. Needs some more work though...

2004-11-17  Manish Singh  <yosh@gimp.org>

 * plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled
 library.

 * plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer
 for GimpProcBrowserApplyCallback.

 * plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to
 scheme style if scheme_names in the proc info pane too.

 * plug-ins/dbbrowser/procedure-browser.c
 * plug-ins/script-fu/script-fu-console.c: pass NULL as user_data.

 * plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la.

 * plug-ins/pygimp/Makefile.am
 * plug-ins/pygimp/procbrowser.c: new module, which wraps
 libgimprocbrowser.

 * plug-ins/pygimp/gimpmodule.c
 * plug-ins/pygimp/pygimp.h
 * plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other
 modules can use it.

 * plug-ins/pygimp/plug-ins/pdbbrowse.py
 * plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser.

2004-11-17  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c: added a utility
 function to reduce code duplication.

2004-11-17  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.[ch]
 * plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin
 Cozens which adds (script-fu-menu-register) and allows scripts to
 register their menu_paths the same undeprecated way as plug-ins.
 Fixes bug #158117.

 * plug-ins/script-fu/scripts/test-sphere.scm: example how to use
 the new API. Doesn't change strings because test-shpere.scm is an
 untranslated example script.

2004-11-17  Michael Natterer  <mitch@gimp.org>

 Made plug-in menu registration work the same way for ordinary and
 temporary procedures. Addresses bug #158117.

 * app/core/gimp-gui.[ch]: added "const gchar *menu_path" to
 gimp_menus_create_entry().

 * app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is
 NULL, behave as before and create an action and its menu entries
 for all the procedure's menu_paths. If it is non-NULL, skip action
 creation and create a menu entry just for that path.

 * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call
 gimp_menus_create_entry() with a NULL menu path and call it if
 proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so
 it creates at least the procedure's action, even if it has
 no menu_path (yet).

 * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both
 the list of procs and temp_procs when trying to register the
 entry.  Allow ordinary procedures and extensions to install stuff
 at query() and init() time and allow temp_procs to install stuff
 at any time.

 * app/pdb/plug_in_cmds.c: regenerated.

2004-11-17  Michael Natterer  <mitch@gimp.org>

 * plug-ins/dbbrowser/gimpprocbox.c
 * plug-ins/dbbrowser/gimpprocbrowser.[ch]
 * plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation
 of moving it to a more public place.

 * plug-ins/dbbrowser/procedure-browser.c
 * plug-ins/script-fu/script-fu-console.c: changed accordingly.

2004-11-17  Sven Neumann  <sven@gimp.org>

 * Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc
 here since it only causes 'make distcheck' to break earlier as usual.

2004-11-17  Sven Neumann  <sven@gimp.org>

 * plug-ins/rcm/Makefile.am
 * plug-ins/rcm/rcm_callback.c
 * plug-ins/rcm/rcm_dialog.c
 * plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot
 that replaces the XPM icons with stock icons (bug #140202).

 * plug-ins/rcm/pixmaps/*.xpm: removed.

 * plug-ins/Lighting/lighting_stock.c
 * plug-ins/MapObject/mapobject_stock.c
 * plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake
 in the icon factory code.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
 be_verbose.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp
 objects (bug #158392). Patch by Joao S. O. Bueno.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/gimpui.py: Use img.name if filename is not
 available (bug #158392). Patch by Joao S. O. Bueno.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/gimpfu.py
 * plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325).
 Patch by Joao S. O. Bueno.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103).
 Patch by Joao S. O. Bueno.
 
2004-11-16  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts.

2004-11-16  Manish Singh  <yosh@gimp.org>

 * configure.in: 
 * plug-ins/pygimp/Makefile.am: Compile pygimp with
 -fno-strict-aliasing if the compiler supports it.

 * plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for
 everything but the filesel, for slightly more consistency with
 script-fu. Addresses #124791.

 * plug-ins/pygimp/gimpmodule.c: Wrapped
 gimp_context_{get,set}_gradient and
 gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated
 versions of these, and rewrote them in terms of the new functions.

2004-11-17  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in.c (plug_in_close): replaced the
 while(plug_in->temp_procs) "loop" which called
 plug_in_proc_frame_quit() by a real for()-loop iterating over the
 list of PlugInProcFrames, calling g_main_loop_quit() on each main
 loop. The old version did not unroll the stack but looped
 infinitely. Spotted by Yosh.

2004-11-17  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_selection.c
 * plug-ins/imagemap/imap_preferences.c: silent the compiler.

2004-11-17  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund
 which adds EXIF thumbnail loading and saving.
 Fixes bugs #155761 and #158190.

2004-11-16  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig-style.c
 * plug-ins/gfig/gfig-style.h
 * plug-ins/gfig/gfig-types.h
 * plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke
 the painting or not.

2004-11-16  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a
 shapeburst blend.  This is very slow, but I dont see how it could be
 done otherwise.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpfgbgeditor.c: get rid of the
 gimp_fg_bg_editor_context_changed() callback and
 g_signal_connect_swapped() gtk_widget_queue_draw() directly.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpchanneltreeview.c: implement
 GimpDockedInterface::set_context() and set the context of the
 embedded GimpComponentEditor. Fixes NULL-context crashes in
 action callbacks when invoked from the component editor.
 Spotted by Jimmac.

 Unrelated:

 * app/widgets/gimpitemtreeview.c: get rid of the
 gimp_item_tree_view_context_changed() callback and
 g_signal_connect_swapped() gimp_item_tree_view_set_image()
 directly.

2004-11-16  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jigsaw.c: added missing braces around initializer.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: renamed the new
 drawable_foo_defaults() functions to drawable_foo_default() to be
 consistent with paintbrush_default() and friends.

 * tools/pdbgen/pdb/transform_tools.pdb
 * libgimp/gimp.def: changed accordingly.

 * app/pdb/drawable_transform_cmds.c
 * app/pdb/transform_tools_cmds.c
 * libgimp/gimpdrawabletransform_pdb.[ch]
 * libgimp/gimptransformtools_pdb.c: regenerated.

 * plug-ins/script-fu/scripts/coolmetal-logo.scm
 * plug-ins/script-fu/scripts/image-structure.scm
 * plug-ins/script-fu/scripts/text-circle.scm: follow the API change.

2004-11-16  Sven Neumann  <sven@gimp.org>

 * app/config/gimpbaseconfig.c: increased default tile-cache-size
 to 128MB.

 * app/config/gimpcoreconfig.c: increased default undo size to 16MB.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/image.pdb
 * tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated
 functions "selection_clear", "image_set_cmap" and "image_get_cmap".

 * app/pdb/procedural_db.c: and added them to the compat hash table
 because they have undeprecated replacements with identical
 signature.

 * libgimp/gimpselection.[ch]: added gimp_selection_clear() here
 instead because we need the symbol in libgimp.

 * app/pdb/image_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/selection_cmds.c
 * libgimp/gimpselection_pdb.[ch]: regenerated.

2004-11-16  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dobject.h: renamed the DObject type to
 GfigObject, according to our common type naming.  This type will
 certainly become an abstract class in a near future.

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-bezier.h
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-line.h
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-poly.h
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig-types.h
 * plug-ins/gfig/gfig.c
 * plug-ins/gfig/gfig.h: changed accordingly.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
 removed redundant "gimage" parameter.

 * app/tools/gimpeditselectiontool.c: changed accordingly.

2004-11-16  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpchannel-select.c
 * app/core/gimpchannel.c
 * app/core/gimpdrawable-desaturate.c
 * app/core/gimpdrawable-equalize.c
 * app/core/gimpdrawable-histogram.c
 * app/core/gimpdrawable-invert.c
 * app/core/gimpdrawable-levels.c
 * app/core/gimpdrawable-offset.c
 * app/core/gimpdrawable-stroke.c
 * app/core/gimpdrawable-transform.c
 * app/core/gimpdrawable.c
 * app/core/gimpitem-linked.c
 * app/core/gimpitem.c
 * app/core/gimplayer.c
 * app/core/gimpselection.c
 * app/paint/gimppaintcore-stroke.c
 * app/text/gimptextlayer.c: in all functions which somehow
 (explicitely or implicitely) touch undo, either g_return_if_fail()
 on gimp_item_is_attached() or simply don't push an undo step if
 feasible (e.g. for simple stuff like layer opacity).

 * tools/pdbgen/pdb/color.pdb
 * tools/pdbgen/pdb/drawable.pdb
 * tools/pdbgen/pdb/image.pdb
 * tools/pdbgen/pdb/layer.pdb
 * tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail
 accordingly so they don't run into the assertions added above.

 * app/pdb/color_cmds.c
 * app/pdb/drawable_cmds.c
 * app/pdb/image_cmds.c
 * app/pdb/layer_cmds.c
 * app/pdb/paint_tools_cmds.c: regenerated.

2004-11-16  Sven Neumann  <sven@gimp.org>

 * app/actions/file-commands.c
 * app/dialogs/file-save-dialog.c
 * app/file/file-save.[ch]
 * app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
 "set_image_clean" parameters into a single "save_a_copy"
 parameter.  When saving a copy, attach the used URI to the image and
 let the "Save a Copy" file chooser default to the last used value.

2004-11-16  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425).

2004-11-15  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan.

 * plug-ins/gfig/gfig-line.[ch]: smallish style fix.

2004-11-15  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse
 tool (a lot more elliptical) by Jimmac and Zigomar.

2004-11-15  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
 limit the number of file extensions that are added to the file
 filter menu to keep the file dialog from growing too wide.

2004-11-15  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Further optimization of
 perspective tool preview - never calculate the same vertex more
 than once.

2004-11-15  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
 better fix for bug #158369.

2004-11-15  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
 return early if gimp_file_proc_view_get_proc() didn't return a file
 procedure. Should fix bug #158369.

2004-11-15  Øyvind Kolås  <pippin@gimp.org>

 * docs/gimp.txt: removed, outdated.
 * docs/make_todo: removed, unused.

2004-11-15  Sven Neumann  <sven@gimp.org>

 * app/dialogs/print-size-dialog.c: started to redo this dialog
 without using a GimpSizeBox. The widgets aren't connected, so it
 isn't usable yet.
 
 * app/widgets/gimpprogressbox.c
 * app/widgets/gimpprogressdialog.c
 * app/widgets/gimpsizebox.c: trivial cleanups.

 * data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * app/actions/image-commands.c: converted error messages that should
 never appear to warnings.

2004-11-14  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by
 this sequence: draw a line, delete it, redraw something), and
 corrected some ui spacing.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * app/core/gimppalette-import.c: applied a (slightly modified)
 patch from Nickolay V. Shmyrev that changes the palette import
 function to not only read palettes in the RIFF format but also
 GIMP and Photoshop ACT palette files (bug #158297).

2004-11-14  Sven Neumann  <sven@gimp.org>

 * Makefile.am (EXTRA_DIST)
 * MAINTAINERS
 * PLUGIN_MAINTAINERS
 * TODO.xml: removed these files from the tarball and from CVS.
 Doesn't make sense to keep unmaintained files around that provide
 outdated and in large parts wrong information.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c (load_button_callback): use the
 proper parent widget.

2004-11-14  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * configure.in
 * plug-ins/rcm/Makefile.am
 * plug-ins/rcm/images/Makefile.am
 * plug-ins/rcm/images/rcm-360.png
 * plug-ins/rcm/images/rcm-a-b.png
 * plug-ins/rcm/images/rcm-ccw.png
 * plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM
 icons used by the RCM plug-in. Added rules to build a header file
 that can be used to get rid of the XPM files (bug #140202).

2004-11-14  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dialog.h
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-dobject.h
 * plug-ins/gfig/gfig-types.h
 * plug-ins/gfig/gfig.c
 * plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList.
 Makes the code cleaner and less error prone.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot
 that replaces the XPM icons with pixbufs (bug #140202).

 * plug-ins/pagecurl/curl[0-7].xpm: removed.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/gimpressionist/Makefile.am: fixed typo.

 * plug-ins/pagecurl/Makefile.am
 * plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM
 icons used by the PageCurl plug-in. Added rules to build a header
 file that can be used to get rid of the XPM files (bug #140202).

2004-11-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Eliminated about 396
 floating-point divides per frame in the persective preview.

2004-11-13  Manish Singh  <yosh@gimp.org>

 Fix a bunch of warnings from Sparse:

 * app/actions/dockable-commands.c
 * app/actions/layers-actions.c
 * app/actions/view-commands.c
 * app/base/pixel-surround.c
 * app/config/gimpconfig-utils.c
 * app/config/gimpscanner.c
 * app/core/gimpbrushgenerated.c
 * app/core/gimpcontainer.c
 * app/core/gimpimage.c
 * app/dialogs/palette-import-dialog.c
 * app/file/gimprecentlist.c
 * app/plug-in/plug-in-params.c
 * app/text/gimptext-compat.c
 * app/text/gimptext-parasite.c
 * app/vectors/gimpbezierstroke.c
 * app/vectors/gimpstroke.c
 * app/widgets/gimpcellrendereraccel.c
 * app/widgets/gimpselectiondata.c
 * app/xcf/xcf.c
 * libgimp/gimp.c
 * libgimpthumb/gimpthumb-utils.c
 * libgimpthumb/gimpthumbnail.c
 * modules/cdisplay_proof.c
 * plug-ins/Lighting/lighting_ui.c
 * plug-ins/common/csource.c
 * plug-ins/common/glasstile.c
 * plug-ins/common/nova.c 
 * plug-ins/common/pcx.c
 * plug-ins/common/pnm.c
 * plug-ins/common/randomize.c
 * plug-ins/common/screenshot.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/spheredesigner.c
 * plug-ins/common/wind.c 
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gimpressionist/gimpressionist.c
 * plug-ins/ifscompose/ifscompose.c
 * plug-ins/print/gimp_main_window.c
 * plug-ins/print/print.c: Cleanup integer vs. pointer confusion.

 * app/base/temp-buf.c
 * app/dialogs/about-dialog.c
 * plug-ins/common/bumpmap.c
 * plug-ins/common/jigsaw.c
 * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.

 * app/config/gimpconfig-deserialize.c
 * app/config/gimpconfig-path.c
 * app/config/gimpconfigwriter.c
 * app/core/gimpgradient.c
 * app/tools/gimpdrawtool.c
 * plug-ins/common/nlfilt.c
 * plug-ins/common/unsharp.c
 * plug-ins/common/zealouscrop.c: Define inline functions before they
 are used.

 * app/core/gimpdrawable-blend.c: PixelRegion definition was changed
 some time ago, but the initialization here didn't change. Fix it.

 * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
 assign token twice in a row.

 * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
 need to initialize file_data, since the code fills out all the fields.

 * plug-ins/common/CML_explorer.c
 * plug-ins/common/vpropagate.c: Declare function pointers fully.

 * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
 we assume we can use the "inline" keyword always.

 * plug-ins/common/psd_save.c
 * plug-ins/common/vinvert.c
 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig.c
 * plug-ins/gimpressionist/orientmap.c
 * plug-ins/gimpressionist/placement.c
 * plug-ins/gimpressionist/sizemap.c
 * plug-ins/imagemap/imap_grid.c
 * plug-ins/imagemap/imap_main.c
 * plug-ins/imagemap/imap_preferences.c
 * plug-ins/imagemap/imap_settings.c
 * plug-ins/maze/maze.c
 * plug-ins/sel2path/curve.c
 * plug-ins/sel2path/fit.c
 * plug-ins/sel2path/pxl-outline.c
 * plug-ins/sel2path/spline.c
 * plug-ins/xjt/xjt.c: Functions with no args should be declared
 with (void).

 * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
 the compiler.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * themes/Default/images/Makefile.am
 * themes/Default/images/stock-center-16.png
 * themes/Default/images/stock-center-24.png
 * themes/Default/images/stock-print-resolution-16.png
 * themes/Default/images/stock-print-resolution-24.png: new icons
 drawn by Jimmac.

 * libgimpwidgets/gimpstock.[ch]: registered the new icons.

 * app/actions/image-actions.c
 * app/dialogs/print-size-dialog.c
 * app/dialogs/resize-dialog.c
 * plug-ins/ifscompose/ifscompose.c: use them.

2004-11-14  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version to 2.2-pre2.

2004-11-13  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so
 that gimp_image_set_filename() validates that it is called with
 a filename in the filesystem encoding which can safely be converted
 to UTF-8 and back. Fixes #153751.

 * app/pdb/image_cmds.c
 * libgimp/gimpimage_pdb.c: Regenerated.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/print-size-dialog.[ch]: new files for the Print Size
 dialog that was missing. Still work in progress...

 * app/actions/image-actions.c
 * app/actions/image-commands.[ch]
 * app/widgets/gimphelp-ids.h
 * menus/image-menu.xml.in: integrate the new dialog.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear()
 in favor of gimp_selection_none(). Fixes bug #156765.

 * app/pdb/selection_cmds.c
 * libgimp/gimpselection_pdb.[ch]: regenerated.

2004-11-13  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/gfig/gfig.c
 * plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to
 gimp_selection_none() (bug #156765).

2004-11-13  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/gimp-headers.scm
 * plug-ins/script-fu/scripts/gimp-labels.scm
 * plug-ins/script-fu/scripts/news-text.scm
 * plug-ins/script-fu/scripts/speed-text.scm: Changed calls to
 gimp-selection-clear to use gimp-selection-none in preparation
 for the deprecation of -clear. (bug #156765)

2004-11-13  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/image.pdb: document the fact that
 gimp_image_get_filename() returns the filename in the filesystem
 encoding. Fixed gimp_image_get_name() to actually return the name
 in UTF-8 encoding.

 * app/pdb/image_cmds.c
 * libgimp/gimpimage_pdb.c: Regenerated.

 * app/vectors/gimpbezierstroke.h: formatting.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimagefile.[ch]
 * app/file/file-open.c
 * app/file/file-save.c: pass the MIME type from the save procedure
 to gimp_imagefile_save_thumbnail() so that it can be stored with
 the thumbnail.

 * tools/pdbgen/pdb/fileops.pdb
 * app/pdb/fileops_cmds.c: changed accordingly.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-in-proc-def.[ch]
 * app/plug-in/plug-in-rc.c
 * app/plug-in/plug-ins.[ch]: allow to associate a procedure for
 thumbnail loading with any file load procedure.

 * tools/pdbgen/pdb/fileops.pdb: export this functionality to the
 PDB as gimp_register_thumbnail_loader().

 * app/pdb/fileops_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpfileops_pdb.[ch]: regenerated.

 * app/core/gimpimagefile.c
 * app/file/file-open.[ch]: when creating a thumbnail for an image
 file, use a thumbnail load procedure if available.

 * plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure
 that allows to load a small preview of the SVG image.

2004-11-13  DindinX  <dindinx@gimp.org>

 * app/actions/layers-actions.c: added back <control>H as a shortcut
 for "Anchor Layer".  Spotted by Bruno Ronzani.

2004-11-13  DindinX  <dindinx@gimp.org>

 * plug-ins/common/retinex.c: use a GimpAspectPreview instead of a
 GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour
 of the progress bar.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * libgimpbase/gimputils.c (gimp_strip_uline): changed based on a
 patch by Joao S. O. Bueno to remove mnemonics as used in languages
 like Chinese. Fixes bug #157561.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/ifscompose/README.ifscompose: updated link to the
 tutorial (pointed out by Alan Horkan) and added another link.

 * plug-ins/ifscompose/ifscompose.c: changed plug-in name from
 "IfsCompose" to "IFS Fractal". Sorry for the late string changes
 but the old name definitely was akward and probably hard to
 translate anyway. Fixes bug #157135.

 * plug-ins/ifscompose/ifscompose_storage.c: removed trailing
 whitespace.

2004-11-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/retinex.c (retinex_dialog): fixed table size.

2004-11-13  Simon Budig  <simon@gimp.org>

 * app/core/gimpimage-merge.c: Return the active layer instead of
 the bottom layer when just merging down a floating selection.
 Untabbified.

 Fixes bug #158130.

2004-11-12  Sven Neumann  <sven@gimp.org>

 * app/config/gimpconfig-dump.c: better fix for bug #157971.

 * docs/gimprc.5.in: regenerated.

2004-11-12  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/images/stock-show-all.png
 * plug-ins/gfig/images/stock-select-object.png: new icons made by
 Jimmac.

2004-11-12  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage-undo-push.c: disallow non-attached items
 to be pushed to the undo stack.

2004-11-12  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/images/stock-show-all.png
 * plug-ins/gfig/images/stock-select-object.png: added these two stock
 icons. Jimmac, these two are screaming to be redone, please.

 * plug-ins/gfig/images/Makefile.am: added these icons.

 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-bezier.h
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-poly.h
 * plug-ins/gfig/gfig-spiral.c
 * plug-ins/gfig/gfig-spiral.h
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig-star.h
 * plug-ins/gfig/gfig-stock.c
 * plug-ins/gfig/gfig-stock.h
 * plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager
 toolbar, which makes the code simpler and easier to read.

2004-11-12  Sven Neumann  <sven@gimp.org>

 * app/dialogs/tips-dialog.c: added icons to the Previous/Next
 buttons (bug #158004).

2004-11-11  Sven Neumann  <sven@gimp.org>

 * app/gui/splash.c: lowered labels a few pixels.

2004-11-11  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: minor code cleanup.

2004-11-11  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and
 automagically have it translated!  The button bar will follow the same
 path.  Remove the now useless "Paint" button.

2004-11-11  Sven Neumann  <sven@gimp.org>

 * app/config/gimpconfig-dump.c: groff doesn't like lines to start
 with a single quote, we better escape it. Fixes bug #157971.

 * docs/gimprc.5.in: regenerated.

2004-11-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-edit.c
 * app/core/gimpdrawable-blend.c
 * app/core/gimpdrawable-bucket-fill.c
 * app/core/gimpitem.c (gimp_item_stroke): added precondition
 checks for gimp_item_is_attached() and removed checks for
 gimp_item_get_image() to actually return an image (because it
 always returns an image).

 * tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable
 is not attached.

 * app/pdb/edit_cmds.c: regenerated.

2004-11-11  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/add-bevel.scm
 * plug-ins/script-fu/scripts/addborder.scm
 * plug-ins/script-fu/scripts/carve-it.scm
 * plug-ins/script-fu/scripts/carved-logo.scm
 * plug-ins/script-fu/scripts/chip-away.scm
 * plug-ins/script-fu/scripts/clothify.scm
 * plug-ins/script-fu/scripts/font-map.scm
 * plug-ins/script-fu/scripts/slide.scm
 * plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-*
 functions on drawables which are not added to an image because
 this will be forbidden soon (because it can trash the image's undo
 stack).
 
2004-11-11  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/lava.scm: replaced
 undo-disable/enable by undo-group-start/end.

2004-11-11  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
 call gimp_image_flush() after committing the image_map so the
 menus are up-to-date. Fixes bug #157914.

2004-11-11  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Use the transform
 tool coordinates when creating subdivisions, not the
 texture coordinates. Fixes breakage with layers that are not
 the image size.

2004-11-11  Jay Cox  <jaycox@gimp.org>

 * app/base/brush-scale.c: Keep computed brush values from
 overflowing with large reduction factors.  Fixes bug #76228.

2004-11-11  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpintstore.c
 * app/vectors/gimpvectors-import.c: please the overly pedantic
 IRIX MIPSpro compiler and don't initialize structs with
 non-constant values.

2004-11-10  Sven Neumann  <sven@gimp.org>

 * app/file/file-open.c (file_open_layer): add the image to the
 list of recently used documents. Fixes bug #157879.

2004-11-10  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the
 tools and made the dialog a bit smaller.

2004-11-10  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/mail.c: added a menu icon (compiled-in).

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-handlers.c
 (gimp_display_shell_resolution_changed_handler): if dot_for_dot is
 off, resolution change has the same effect as size change, so call
 gimp_display_shell_size_changed_handler(). Fixes display garbage.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * plug-ins/winicon/icodialog.[ch]
 * plug-ins/winicon/icoload.[ch]
 * plug-ins/winicon/icosave.[ch]
 * plug-ins/winicon/main.[ch]: call progress functions
 unconditionally; removed global "interactive" variable; use
 standard strings for open/save progress messages; gui, indentation
 & coding style cleanup; untabified.

2004-11-10  Michael Schumacher <schumaml@cvs.gnome.org>

 * plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann
 with some minor modifications. Fixes bug #157612
 Removed some unused variables.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2".

2004-11-10  Sven Neumann  <sven@gimp.org>

 * app/dialogs/preferences-dialog.c: set the padding-mode to custom
 color if a custom color is choosen. Fixes bug #157844.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed
 capitalization of notebook tab label.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to
 gimp_flags_get_first_value(). Reordered functions so enum and
 flags functions are grouped together. Added missing docs.

 * libgimpbase/gimpbase.def: changed accordingly.

2004-11-09  Jay Cox  <jaycox@gimp.org>

 * plug-ins/common/psd.c: Skip resources with unknown signatures
 instead of quiting.  Fixes bug #142468, and bug #152728

 * app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds,
 and gimp_drawable_mask_intersect: reinitialize the return values
 after calling gimp_channel_bounds because gimp_channel_bounds
 overwrites the values even when it returns false.  This fixes the
 bug where the gimp crashes when running color tools on layers
 smaller than the image, and processes only part of the image when
 the layer is larger than the image size.

2004-11-10  Sven Neumann  <sven@gimp.org>

 * HACKING: some updates.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * plug-ins/ifscompose/ifscompose.c: use a UI manager created
 toolbar instead of two rows of buttons. Added a "dummy-menubar" so
 the popup menu shows shortcuts again. Removed "Preview" and "Auto"
 buttons since the preview doesn't block the GUI and can always be
 updated.

2004-11-10  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpstatusbar.[ch]: added new function
 gimp_statusbar_push_length(), which works exactly like
 push_coords() but takes only one value plus a GimpOrientationType
 for specifying the value's axis.

 * app/tools/gimptool.[ch]: added the corresponding
 gimp_tool_push_status_length().

 * app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
 so the guide position is shown in the selected display unit.
 Cleaned up the status message code a bit.

2004-11-10  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the
 anchor.

2004-11-09  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/bmpread.c: if the file has space in the colormap for
 more than 256 entries, ignore them instead of failing. Fixes bug
 #157775.

2004-11-09  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images
 load again. Fixes bug #157764.

2004-11-09  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_canvas_tool_events): pass (gint)-truncated
 coordinates instead of RINT()-rounded ones to
 gimp_display_shell_update_cursor(). Restores correct coordinates
 display for zoomed-in display and fixes bug #153534.

 * app/tools/gimpmovetool.c: added statusbar messages including the
 (rounded) guide coordinate. Keeps bug #141719 closed.

2004-11-09  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c (gimp_display_shell_new): don't
 connect to "event" and don't connect any canvas event to
 gimp_display_shell_events(). Connect all tool events separately
 (doesn't include "configure-event" and thus fixes bug #141543).

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_canvas_tool_events): call
 gimp_display_shell_events() manually before doing tool event
 processing.

 * app/display/gimpdisplayshell.c
 * app/display/gimpdisplayshell-callbacks.[ch]: connect to
 "size_allocate" of the canvas, not to "configure_event"
 (suggested by Owen in bug #141543).

 * app/display/gimpdisplayshell-callbacks.[ch]: removed
 gimp_display_shell_popup_menu().

 (gimp_display_shell_origin_button_press): emit "popup-menu" on the
 shell manually instead of calling above function.

 * app/display/gimpdisplayshell.c: added the whole menu popup code
 here.

2004-11-09  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue
 a resize. Fixes remaining issues with bug #157495.

2004-11-09  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/url.c: removed debug output.

2004-11-08  Sven Neumann  <sven@gimp.org>

 * app/dialogs/user-install-dialog.c (user_install_migrate_files):
 don't copy menurc, the format changed anyway.
 
2004-11-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_ok):
 actually retrieve the value from the GtkEntry for SF-VALUE.

2004-11-08  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert
 Jordaens which adds the missing gimp_layer_from_mask() API.
 Addresses bug #138662.

 * app/pdb/internal_procs.c
 * app/pdb/layer_cmds.c
 * libgimp/gimplayer_pdb.[ch]. regenerated.

 * libgimp/gimp.def: changed accordingly.

2004-11-08  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: removed garbage
 from beginning of file. Removed DOS line breaks.

2004-11-08  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimppixelfetcher.c: added docs derived from a patch from
 Cai Qian (bug #156271).

2004-11-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/screenshot.c: changed label of default action
 button to "Grab".

2004-11-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/CEL.c
 * plug-ins/common/CML_explorer.c
 * plug-ins/common/channel_mixer.c
 * plug-ins/common/gqbist.c
 * plug-ins/common/spheredesigner.c
 * plug-ins/flame/flame.c
 * plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in
 file chooser dialogs. Set the default response for file dialogs.

2004-11-08  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/resize-dialog.c (resize_dialog_response)
 * app/dialogs/scale-dialog.c (scale_dialog_response): replaced
 "case GTK_RESPONSE_CANCEL:" by "default:" so it also catches
 hitting the escape key or clicking the WM close button.

2004-11-08  Øyvind Kolås  <pippin@gimp.org>

 * plug-ins/common/gqbist.c: fixed typo in construction of file
 chooser, use gtk_dialog_run instead of separate callbacks for
 the responses of the file chooser dialog.

2004-11-08  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdrawable.c (gimp_drawable_mask_bounds)
 (gimp_drawable_mask_intersect): initialize the return values before
 checking if the drawable is attached. Keeps GIMP from going mad if
 this assertion is ever triggered.

2004-11-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c: don't connect the help browser to
 the help system.

2004-11-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: register the
 compatibility procedure with the correct name.

2004-11-07  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was
 taken from label field).

2004-11-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager.

2004-11-07  Sigurd Gartmann  <sigurd-translate@brogar.org>

 * configure.in: Added support for the new locale nb to ALL_LINGUAS.

2004-11-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/channel_mixer.c (query): the menu label should
 have three dots (bug #157580).

2004-11-07  DindinX  <dindinx@gimp.org>

 * plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and
 use a GtkListStore instead of the long-time deprecated GtkList. Done
 some small cleanups, too.

2004-11-06  Sven Neumann  <sven@gimp.org>

 * app/core/gimpbrushgenerated.c: changed minimum brush radius from
 1.0 to 0.1.

 * app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
 be set in the brush editor. Fixes bug #157508.

2004-11-06  Sven Neumann  <sven@gimp.org>

 * app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here.

2004-11-06  Sven Neumann  <sven@gimp.org>

 * app/dialogs/preferences-dialog.c: fixed typo (bug #157513).

2004-11-06  Sven Neumann  <sven@gimp.org>

 * app/dialogs/convert-dialog.c (convert_dialog_new): removed
 trailing period from check button label. Fixes bug #157511.

2004-11-06  Sven Neumann  <sven@gimp.org>

 * app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
 the Reset functionality (bug #157495). The offset box is still not
 working correctly.

 * app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
 check for availability of the size entry before accessing it.

2004-11-06  Sven Neumann  <sven@gimp.org>

 New Win32 icons contributed by Jernej Simoncic:
 
 * app/Makefile.am
 * app/makefile.msc
 * app/gimp.rc
 * app/fileicon.ico: added new file icon for the Win32 build.

 * app/wilber.ico: nicer application icon for the Win32 build.

2004-11-05  Michael Natterer  <mitch@gimp.org>

 * plug-ins/maze/maze.c
 * plug-ins/maze/maze_face.c: some irrelevant cleanups while doing
 code review.

2004-11-05  Michael Natterer  <mitch@gimp.org>

 * plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED
 because it's no longer needed. Cleaned up #defines and
 declarations. Removed tabs and trailing whitespace.

2004-11-04  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpsessioninfo.c: be more tolerant and silently
 skip entries that the dialog factory doesn't recognize.

 * app/widgets/gimpdialogfactory.c: minor cleanup.

2004-11-04  Sven Neumann  <sven@gimp.org>

 * app/dialogs/user-install-dialog.c (user_install_response): don't
 save the (empty) gimprc after migrating the user settings.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/uniteditor.c: undeprecated by using a
 GtkUIManager for creating the toolbar. Some cleanup and code
 reordering.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED
 only for future versions of GLib, GTK+ and Pango because the
 upcoming new stable versions add no new deprecations that are
 relevant for the GIMP source.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * plug-ins/ifscompose/ifscompose.c: some undeprecation and
 cleanup. Still uses GtkItemFactory.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 Don't use deprecated GtkToolbar API in GimpTextEditor:

 * app/actions/Makefile.am
 * app/actions/actions.c
 * app/actions/text-editor-actions.[ch]
 * app/actions/text-editor-commands.[ch]: added acions and
 callbacks for the new "text-editor" action group.

 * app/menus/menus.c: register a "<TextEditor>" UI manager.

 * menus/Makefile.am
 * menus/text-editor-toolbar.xml: new file for the toolbar.

 * app/widgets/gimptexteditor.[ch]: use the toolbar created by the
 UI manager instead of constructing it using deprecated API.

 * app/tools/gimptextoptions.c: changed accordingly.

 * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
 (used by text-editor-commands.c).

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
 of a GtkItemFactory. Added virtual function ::get_action_type()
 and create the manager's actions manually using that action type
 instead of using gtk_action_group_add_actions().

 * app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
 creates GimpActions (which can have a color attached) instead of
 GtkActions. Changed the menu item visibility and color preview
 code accordingly.

 * app/widgets/Makefile.am
 * app/widgets/gimpitemfactory.[ch]: finally removed.

 * configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED

 * libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h>
 explicitely and #undef GTK_DISABLE_DEPRECATED only around the
 inclusion if it was defined before.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpunitcache.h
 * libgimpbase/gimpchecks.h
 * libgimpbase/gimpdatafiles.h
 * libgimpbase/gimplimits.h
 * libgimpbase/gimpmemsize.h
 * libgimpbase/gimputils.h
 * libgimpbase/gimpwin32-io.h
 * libgimpthumb/gimpthumb-enums.h
 * libgimpthumb/gimpthumb-error.h
 * libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS.

2004-11-04  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/ccanalyze.c
 * plug-ins/common/uniteditor.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-preview.c
 * plug-ins/ifscompose/ifscompose.c
 * plug-ins/imagemap/imap_misc.c
 * plug-ins/imagemap/imap_selection.c
 * plug-ins/imagemap/imap_toolbar.c
 * plug-ins/imagemap/imap_tools.c
 * plug-ins/print/gimp_color_window.c: stop using deprecated
 functions, added some #undef GTK_DISABLE_DEPRECATED where needed.

2004-11-03  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/module-dialog.c
 * plug-ins/dbbrowser/gimpprocbrowser.c
 * plug-ins/dbbrowser/plugin-browser.c: use
 gtk_tree_model_get_iter_first() instead of the deprecated
 _get_iter_root().

 * app/display/gimpdisplayshell-callbacks.c: don't include
 "widgets/gimpitemfactory.h".

2004-11-03  Øyvind Kolås  <pippin@gimp.org>

 * app/base/gimphistogram.h: %s/historgam/histogram/
 
2004-11-03  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
 forget to g_free(editor->segments).

2004-11-03  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpscalecombobox.c
 (gimp_scale_combo_box_mru_remove_last)
 * app/widgets/gimpeditor.c (gimp_editor_add_action_button)
 * app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.

2004-11-03  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
 plugged a mem-leak.

 * app/widgets/gimpviewrendererimagefile.c
 (gimp_view_renderer_imagefile_render): don't leak the pixbuf here.

 * app/widgets/gimpviewrenderer-frame.c: added a comment.

2004-11-03  Michael Natterer  <mitch@gimp.org>

 * app/paint-funcs/paint-funcs.c (combine_sub_region): applied
 patch from Joao S. O. Bueno which moves assignments into an "else"
 branch and thus optimizes the (common) "if" branch. Did some
 cosmetic cleanups.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
 don't silently return when there is already a script running but
 show a message instead. Unfortunately introduces two new strings,
 but bugs are bugs. Fixes bug #123882.

2004-11-02  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor
 cleanup.

 * libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do
 the right thing. Used to do the wrong thing when called with a
 thumbnail size which is not from the GimpThumbSize enum.

2004-11-02  Sven Neumann  <sven@gimp.org>

 * app/actions/image-commands.c (image_new_from_image_cmd_callback):
 call image_new_dialog_set() unconditionally. Fixes bug #157096.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: factored out the
 "invoke" bodies to two utility functions, getting rid of *tons* of
 duplicated code.

 * app/pdb/drawable_transform_cmds.c: regenerated (only whitespace
 and comments changed).

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults):
 renamed parameter "interpolation" to "interpolate" as suggested by
 pippin.

 * app/pdb/drawable_transform_cmds.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/user-install-dialog.c (user_install_migrate_files):
 don't copy pluginrc* and themerc*.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpimage.h: one more s/cmap/colormap/.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions.

 * app/pdb/transform_tools_cmds.c
 * libgimp/gimptransformtools_pdb.[ch]: regenerated.

 * plug-ins/common/tiff.c
 * plug-ins/script-fu/scripts/3dTruchet.scm
 * plug-ins/script-fu/scripts/coolmetal-logo.scm
 * plug-ins/script-fu/scripts/image-structure.scm
 * plug-ins/script-fu/scripts/perspective-shadow.scm
 * plug-ins/script-fu/scripts/text-circle.scm
 * plug-ins/script-fu/scripts/truchet.scm: use the new transform API.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: added _defaults()
 variants (flip_defaults, rotate_defaults, ...) for all transform
 functions which finally call gimp_drawable_transform_affine().
 The _defaults() functions don't take the whole interpolation_type,
 supersample etc. parameter overkill, but only a "interpolation"
 boolean like the old PDB wrappers.

 * libgimp/gimp.def: changed accordingly.

 * app/pdb/drawable_transform_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and
 rotate() to flip_simple() and rotate_simple(). Renamed flip_free()
 and rotate_free() to flip() and rotate() (the special cases should
 have a special suffix, not the general ones).

 * libgimp/gimp.def: changed accordingly.

 * app/pdb/drawable_transform_cmds.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/compressor.c (compressors): added missing bzip2
 command lines for Win32.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/bmp/bmpread.c
 * plug-ins/bmp/bmpwrite.c
 * plug-ins/common/CEL.c
 * plug-ins/common/animationplay.c
 * plug-ins/common/animoptimize.c
 * plug-ins/common/autostretch_hsv.c
 * plug-ins/common/c_astretch.c
 * plug-ins/common/ccanalyze.c
 * plug-ins/common/color_enhance.c
 * plug-ins/common/film.c
 * plug-ins/common/gee.c
 * plug-ins/common/gee_zoom.c
 * plug-ins/common/gif.c
 * plug-ins/common/gifload.c
 * plug-ins/common/grid.c
 * plug-ins/common/header.c
 * plug-ins/common/mng.c
 * plug-ins/common/normalize.c
 * plug-ins/common/pcx.c
 * plug-ins/common/png.c
 * plug-ins/common/pnm.c
 * plug-ins/common/postscript.c
 * plug-ins/common/psd.c
 * plug-ins/common/psd_save.c
 * plug-ins/common/raw.c
 * plug-ins/common/sunras.c
 * plug-ins/common/tga.c
 * plug-ins/common/tiff.c
 * plug-ins/common/tile.c
 * plug-ins/common/vinvert.c
 * plug-ins/common/winclipboard.c
 * plug-ins/common/winprint.c
 * plug-ins/common/xbm.c
 * plug-ins/common/xpm.c
 * plug-ins/common/xwd.c
 * plug-ins/fits/fits.c
 * plug-ins/gfli/gfli.c
 * plug-ins/imagemap/imap_preview.c
 * plug-ins/print/print.c
 * plug-ins/pygimp/pygimp-image.c
 * plug-ins/winicon/main.c: use the new "colormap" functions
 instead of the deprecated "cmap" ones.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 More final API cleanup:

 * tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap()
 and deprecated set,get_cmap().

 * libgimpwidgets/gimppreviewarea.[ch]: renamed
 gimp_preview_area_set_cmap() to set_colormap().

 * libgimp/gimp.def
 * libgimp/gimpdrawablepreview.c
 * libgimp/gimpexport.c
 * libgimp/gimpimage.[ch]
 * libgimpwidgets/gimpwidgets.def: changed accordingly.

 * app/pdb/image_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpimage_pdb.[ch]: regenerated.

 (undeprecation of plug-ins will follow...)

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpcroptool.c (crop_recalc): added "gboolean
 recalc_highlight" and call gimp_display_shell_set_highlight() only
 when it's TRUE. Pass TRUE from all places where the crop outline
 actually changed.

 (gimp_crop_tool_control): added back the call to crop_recalc() for
 the RESUME case so the outline gets updated on zoom/scroll, but pass
 recalc_highlight = FALSE because it has not changed.
 Fixes bug #157001.

2004-11-02  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed
 parameter "center" to "auto_center" and removed
 "transform_direction". Renamed rotate() to rotate_free() and
 added a "gboolean auto_center" parameter. Added new function
 rotate() which takes enum GimpRotationType instead of an
 arbiatrary angle so the flip and rotate APIs are symmetric.

 * libgimp/gimp.def: added the gimp_drawable_transform_* stuff.

 * app/pdb/drawable_transform_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-11-02  Sven Neumann  <sven@gimp.org>

 * app/dialogs/image-scale-dialog.c (image_scale_callback): actually
 use the choosen interpolation type. Fixes bug #157102.

2004-11-02  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-dobject.h
 * plug-ins/gfig/gfig-preview.c
 * plug-ins/gfig/gfig-style.h
 * plug-ins/gfig/gfig-types.h
 * plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is
 still there :(

2004-11-01  Øyvind Kolås  <pippin@gimp.org>

 * app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity
 checking for the xcf loader, colormaps read from non indexed images
 are discarded. Does not fix bug #134097, but prevents gimp from
 reloading an impossible state.

2004-11-01  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-transform.[ch]
 (gimp_drawable_transform_flip): renamed "center" to "auto_center".

 (gimp_drawable_transform_rotate): added missing parameters so it
 can be used for a to-be-added PDB wrapper offering a
 GimpRotationType based rotate API.

 Both functions: always clip when transforming a whole channel,
 since they must keep their size.

 (gimp_drawable_transform_affine): actually forward the passed
 "clip_result" to transform_tiles_affine() instead of always FALSE.

2004-11-01  Øyvind Kolås  <pippin@gimp.org>

 * app/pdb/color_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpcolor_pdb.c
 * libgimp/gimpcolor_pdb.h: regenerated
 * tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed
 metainformation from deprecated levels-auto.

2004-11-01  Øyvind Kolås  <pippin@gimp.org>

 * app/actions/drawable-actions.c
 * app/actions/drawable-commands.c
 * app/actions/drawable-commands.h
 * app/base/levels.c
 * app/base/levels.h
 * app/core/gimpdrawable-levels.c
 * app/core/gimpdrawable-levels.h
 * app/pdb/color_cmds.c
 * app/tools/gimplevelstool.c
 * libgimp/gimpcolor_pdb.c
 * menus/image-menu.xml
 * menus/image-menu.xml.in
 * tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto
 to [drawable-]levels-stretch, anticipating other ways to automatically
 determine levels settings, old PDB command maintained, but marked
 as deprecated.

2004-11-01  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
 don't check for file_proc->menu_paths. Our load and save procedure
 don't necessarily register a menu path any longer.

 * app/plug-in/plug-ins.c: minor cleanup.

 * app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
 XCF load and save procedures.

 * tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.

 * app/pdb/fileops_cmds.c
 * libgimp/gimpfileops_pdb.c: regenerated.

2004-11-01  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to
 the transform_options_args() utility function and changed all
 wrappers accordingly. Removed "interpolation", "supersample" and
 "recursion_level" args from drawable_transform_flip().

 * app/pdb/drawable_transform_cmds.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-11-01  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tiff.c (query): fixed typo.

2004-11-01  Michael Natterer  <mitch@gimp.org>

 * app/actions/drawable-actions.c: trailing whitespace.

 * app/actions/drawable-commands.[ch]: partly revert alphabetical
 ordering. Instead, group them as in drawable-actions.c and order
 by alphabet inside the groups (different ordering in *-actions.c
 and *-commands.c is inconvenient for the usual workflow of editing
 both files at the same time).

 * app/core/gimpdrawable-levels.h: indentation.

2004-11-01  Michael Natterer  <mitch@gimp.org>

 * themes/Small/gtkrc: don't change GtkDialog::button_spacing and
 ::action_area_border because it breaks alignment with all other
 dialog spacings or borders (which are hardcoded).

2004-11-01  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses.
 This makes the sources easier to read.

 * plug-ins/gfig/Makefile.am: added gfig-types.h

 * plug-ins/gfig/gfig.h: removed some types definitions and put them
 in gfig-types.h and ...

 * plug-ins/gfig/gfig-dobject.h
 * plug-ins/gfig/gfig-style.h: ...into these files.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * Made 2.2-pre1 release.

2004-10-31  Simon Budig  <simon@gimp.org>

 * data/images/gimp-splash.png: new splash based on a great photo
 (and pumpkin) by Seth Burgess <sjburges@gimp.org>.

2004-10-31  Simon Budig  <simon@gimp.org>

 * plug-ins/common/plasma.c: Fixed handling of 1x1 selection and
 selection out of drawable.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * configure.in: changed gimp_version to 2.2-pre1, to match the
 naming scheme of the 2.0 pre-releases.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/newsprint.c: removed an unused variable.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/dialogs/user-install-dialog.c: when migrating the user
 settings, tolerate errors and create the tmp directory that was
 explicitely not copied.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the
 file permissions also.

 * app/dialogs/user-install-dialog.c: added code to migrate user
 settings from ~/.gimp-2.0. It copies all files (except GIMP swap
 files) and all subdirectories (except tmp) with all files. It
 doesn't recurse into subdirectories.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/config/gimpguiconfig.c: disabled the image area by default
 to reduce some clutter.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/dialogs/user-install-dialog.c: fixed page logic for migration
 of user settings. Still missing code to actually copy the files.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory
 size identifiers.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
 set the active image. Fixes bug #156942.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/dialogs/user-install-dialog.c: started to work on migration of
 user settings (bug #156636). Not at all functional yet.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio
 groups created with gimp_radio_group_new().

2004-10-31  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.c: some more UI improvements.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpsizebox.c: added a size entry to edit the
 resolution. This should close bug #151022.

2004-10-31  Sven Neumann  <sven@gimp.org>

 * app/dialogs/resize-dialog.c: connect the offset controls.

2004-10-30  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at
 the price of a smallish mem-leak that I will fix later.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * app/composite/gimp-composite-generic.c
 (gimp_composite_hue_any_any_any_generic): do nothing if the color
 has no saturation. Patch by Joao S. Bueno. Fixes bug #123296.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * app/actions/image-commands.c (image_scale_cmd_callback): destroy
 the scale dialog when the display is disconnected.

 * app/dialogs/resize-dialog.c: fixed a couple of bugs related to
 the offset area. Still work in progress.

2004-10-30  DindinX  <dindinx@gimp.org>

 * plug-ins/common/newsprint.c: Moved the preview to the left, as
 suggested by Joao S. O. Bueno.

2004-10-30  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-line.c
 * plug-ins/gfig/gfig-line.h
 * plug-ins/gfig/gfig-poly.c
 * plug-ins/gfig/gfig-preview.c
 * plug-ins/gfig/gfig-star.c
 * plug-ins/gfig/gfig-style.c
 * plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still
 work in progress.

 * plug-ins/gfig/pix-data.h: removed this empty, unused file.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * app/config/gimpguiconfig.[ch]
 * app/config/gimprc-blurbs.h
 * app/dialogs/preferences-dialog.c
 * app/tools/gimpmoveoptions.[ch]
 * app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
 Instead added a gimprc option that allows to get the old behaviour
 back.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpmoveoptions.[ch]
 * app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
 patch from Joao S. O. Bueno that adds a tool-option to restore the
 old Move tool behaviour. Fixes bug #156801.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/despeckle.c: applied a patch from Geert Jordaens
 that improves the Despeckle algorithm. See bug #72862.

2004-10-29  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to
 use convert_string() to change name of constant to Scheme format.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * INSTALL
 * NEWS
 * README: updated for 2.2 pre-releases.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno
 that implements the opacity parameters the way it is documented.
 Fixes bug #156750.

2004-10-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/glasstile.c: applied patch from Yeti, updated by
 Kevin Cozens and modified by me. Fixes bug #85261.

2004-10-29  Øyvind Kolås  <pippin@gimp.org>

 * tools/pdbgen/pdb/color.pdb: moved body of code from here.

 * app/core/gimpdrawable-levels.[ch]: to here.
 * app/core/Makefile.am: added gimpdrawable-levels.[ch].
 * app/pdb/color_cmds.c: regenerated.

 * app/actions/drawable-actions.c
 * app/actions/drawable-commands.[ch]: added drawable-layers-auto
 action.

 * app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE.
 * app/menus/image-menu.xml.in: added new auto/White Balance action.
 * app/menus/image-menu.xml: regenerated.

2004-10-29  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
 * app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
 verbose on request.

 * app/plug-in/plug-in.c (plug_in_close): turned warnings into
 messages and respect gimp->be_verbose.

2004-10-29  Øyvind Kolås  <pippin@gimp.org>

 * app/actions/drawable-commands.[ch]
 * app/actions/drawable-actions.[ch]: alphabetized file pending
 addition.

2004-10-29  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/test-sphere.scm: Added notes about
 use of SF-PALETTE.

2004-10-29  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c: pass the name in filesystem encoding to
 gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in.

2004-10-29  Sven Neumann  <sven@gimp.org>

 * app/file/file-utils.c (file_utils_uri_to_utf8_filename): when
 the filename cannot be converted to UTF-8, warn and return the URI
 instead. This is a workaround for the crash described in bug #153751.

2004-10-29  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/dialogs.c (toplevel_entries): added foreign entries
 for the keyboard shortcut and the controller action dialogs.

 * app/dialogs/preferences-dialog.c
 * app/widgets/gimpcontrollereditor.c: register the dialogs with
 the "toplevel" dialog factory so they remember their size and
 position.

2004-10-29  Michael Natterer  <mitch@gimp.org>

 * plug-ins/dbbrowser/gimpprocbrowser.c
 * plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or
 "1 Plug-In Interfaces" but use the singular form instead.

2004-10-29  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/flarefx.c
 * plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR.

 * plug-ins/common/iwarp.c
 * plug-ins/gflare/gflare.c
 * plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview
 cursors. Not quite perfect for IfsCompose (actually needs tool-
 and constext-sensitive cursors) but definitely better than
 before. Fixes bug #90519.

2004-10-29  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the
 docs for gimp_edit_fill().

 * app/pdb/edit_cmds.c
 * libgimp/gimpedit_pdb.c: regenerated.

2004-10-28  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-bezier.c
 * plug-ins/gfig/gfig-bezier.h
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dialog.h
 * plug-ins/gfig/gfig-dobject.c
 * plug-ins/gfig/gfig-dobject.h
 * plug-ins/gfig/gfig-ellipse.c
 * plug-ins/gfig/gfig-grid.c
 * plug-ins/gfig/gfig-grid.h
 * plug-ins/gfig/gfig.c: small cleanups

2004-10-28  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablecombobox.c
 * libgimp/gimpimagecombobox.c: changed the API docs to suggest to
 use gimp_int_combo_box_connect() with these widgets. We don't want
 more people to be caught by bug #156659.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug
 which caused the intersection color to be drawn with the wrong
 shade of gray when drawing on a grayscale drawable.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * app/dialogs/resize-dialog.c: added the offset area back. Still
 work in progress.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c: only create a "Document not
 found" error page if the requested URL was a page to load, not a
 supplementary URL like an image. Fixes bug #138275.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/bmp/bmp.c
 * plug-ins/common/CEL.c
 * plug-ins/common/aa.c
 * plug-ins/common/compressor.c
 * plug-ins/common/csource.c
 * plug-ins/common/dicom.c
 * plug-ins/common/gbr.c
 * plug-ins/common/gif.c
 * plug-ins/common/gifload.c
 * plug-ins/common/gih.c
 * plug-ins/common/gtm.c
 * plug-ins/common/header.c
 * plug-ins/common/jpeg.c
 * plug-ins/common/mng.c
 * plug-ins/common/pat.c
 * plug-ins/common/pcx.c
 * plug-ins/common/pix.c
 * plug-ins/common/png.c
 * plug-ins/common/pnm.c
 * plug-ins/common/postscript.c
 * plug-ins/common/psd.c
 * plug-ins/common/psd_save.c
 * plug-ins/common/psp.c
 * plug-ins/common/sunras.c
 * plug-ins/common/svg.c
 * plug-ins/common/tga.c
 * plug-ins/common/tiff.c
 * plug-ins/common/url.c
 * plug-ins/common/wmf.c
 * plug-ins/common/xbm.c
 * plug-ins/common/xpm.c
 * plug-ins/common/xwd.c
 * plug-ins/faxg3/faxg3.c
 * plug-ins/fits/fits.c
 * plug-ins/gfli/gfli.c
 * plug-ins/sgi/sgi.c
 * plug-ins/winicon/main.c
 * plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register()
 from all plug-ins. File plug-ins don't register into a menu any longer.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/raw.c (query): do not install an extension for
 the raw plug-in to avoid confusion with the dcraw format.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * app/actions/layers-actions.c (layers_actions_update): do not set
 the "layers-mask-add" action insensitive if there's no alpha channel.

 * app/actions/layers-commands.c (layers_add_mask_response): add an
 alpha channel if there isn't one already. Fixes bug #156676.

2004-10-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
 use gimp_int_combo_box_connect() so that the initial selection
 causes the "changed" callback to be run. Should fix bug #156659.

2004-10-28  Øyvind Kolås  <pippin@gimp.org>

 * app/display/gimpdisplayshell-preview.c: Improve preview accuracy of
 perspective transform, by subdiving into a 5x5 grid.

 Fixes bug #152222.

2004-10-27  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Really fixed all cases
 of the perspective tool preview breaking with certain orientations by
 using triangles instead of quads.

2004-10-27  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases
 of the perspective tool preview breaking with certain orientations.

2004-10-27  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/enumcode.pl: Don't declare $first twice.

 * libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail.

 * libgimp/gimpenums.c.tail: Added into CVS.

2004-10-27  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the
 bezier tool options instead of yet another popup window.

 * plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit.

2004-10-27  Øyvind Kolås  <pippin@gimp.org>

 * app/core/gimpdrawable-transform.c: made the fixed point used in
 supersampling configurable (in source) and changed from 15.16 to
 21.10 fixed point.
 
 Fixes bug #128594 for drawables less than 2G wide.

2004-10-27  Michael Schumacher <schumaml@gmx.de>

 * app/widgets/gimpwidgets-utils.c: fixed a typo in
 #include "libgimpbase/gimpwin32-io.h"

2004-10-27  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/gfig-dialog.[ch]
 * plug-ins/gfig/gfig-poly.[ch]
 * plug-ins/gfig/gfig-spiral.[ch]
 * plug-ins/gfig/gfig-star.[ch]
 * plug-ins/gfig/gfig.h: first step of moving all the hidden popup
 dialogs for the tool options in a GtkNotebook showing the options
 within one page for each tool.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/enumcode.pl: removed trailing commmas from output.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/enumcode.pl: fixed loop control in
 _gimp_enums_init(). This caused all plug-ins to crash immidiately.
 You will need to make sure that libgimp/gimpenums.c.tail is
 recreated and appended to libgimp/gimpenums.c

2004-10-27  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
 bounding boxes to x,y,width,height ones. Added
 gimp_transform_matrix_flip_free(). Renamed some parameters to be
 consistent with others. Some internal cleanup.

 * app/tools/gimpperspectivetool.c
 * app/tools/gimpscaletool.c
 * app/tools/gimpsheartool.c
 * tools/pdbgen/pdb/drawable_transform.pdb
 * tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

 * tools/pdbgen/pdb/drawable_transform.pdb
 * tools/pdbgen/pdb/transform_tools.pdb: guard all transform
 wrappers with if(gimp_drawable_mask_intersect(...)), also the
 ones which don't need the returned bounding box.

 * tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
 and added gimp_drawable_transform_matrix() which takes the 9
 coefficients of a 3x3 matrix for ultimate flexibility ;)

 * app/pdb/drawable_transform_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/transform_tools_cmds.c
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * app/actions/dockable-actions.c (dockable_toggle_actions): changed
 menu label from "Show Image Menu" to "Show Image Selection".

 * app/widgets/gimpsizebox.c: unmarked a string for translation.

 * app/dialogs/scale-dialog.c: added back the message when scaling
 an indexed image.

2004-10-27  DindinX  <dindinx@gimp.org>

 * libgimp/gimpaspectpreview.c: really use the second parameter of
 gimp_aspect_preview_new (), so plug-ins can now really remember the
 state of the preview between invocations.

 * libgimpwidgets/gimpscrolledpreview.c: fix a little typo

 * plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a
 boolean value (initial state of the preview) instead of a weird NULL.

2004-10-27  Michael Natterer  <mitch@gimp.org>

 * modules/controller_linux_input.c
 * modules/controller_midi.c: don't g_free(error) but
 g_clear_error(&error) the GError.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * app/dialogs/resize-dialog.[ch]: started to redo the Resize
 dialog in the style of the new Scale dialog. Only halfway done but
 at least the new API is there.

 * app/actions/image-commands.c
 * app/actions/layers-commands.c: changed accordingly.

 * app/dialogs/image-scale-dialog.c: cosmetics.

2004-10-27  DindinX  <dindinx@gimp.org>

 * plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing
 spaces.

2004-10-26  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init,
 called pdb_misc in all procedures.

 * app/pdb/drawable_transform_cmds.c
 * libgimp/gimpdrawabletransform_pdb.c: regenerated.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new
 files gimpdrawabletranform_pdb.[ch].

2004-10-27  Sven Neumann  <sven@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
 dialog that takes care of verifying the user input and optionally
 asking for confirmation. Most of this moved out of image-commands.c.

 * app/actions/image-commands.c: use the new image scale dialog
 even though it doesn't allow to edit the resolution yet. That's a
 temporary regression that will get fixed soon.

 * app/actions/layers-commands.c: cosmetics.

 * app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
 resolution.

 * app/widgets/gimpsizebox.c: fixed cut'n'paste error.

2004-10-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpsizebox.[ch]: added a resolution label similar
 to one in the template editor. Prepared for editable resolution,
 work in progress...

 * app/dialogs/scale-dialog.[ch]: added resolution and resolution
 unit parameters to ScaleDialogCallback.

 * app/actions/layers-commands.c: changed accordingly.

2004-10-26  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.c: commented out the memory size
 label. The visual clutter of it's bold appearance was IMO not
 appropriate. I think the dialog is better without it.

 * app/widgets/gimpsizebox.c: added a pixel size label as in the
 Image New dialog.

2004-10-26  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/enumcode.pl: added gtk-doc comment for
 gimp_enums_get_type_names().

2004-10-26  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/retinex.c: applied patch by Geert Jordaens that
 lets Retinex deal with RGBA drawables. Closes bug #135594 again.

2004-10-26  Sven Neumann  <sven@gimp.org>

 Added new drawable transform API to the PDB. Largely based on
 patches from Joao S. O. Bueno. Fixes bug #137053.

 * app/core/gimpdrawable-transform.[ch]: added missing parameters
 to gimp_drawable_transform_flip().

 * tools/pdbgen/pdb/transform_tools.pdb: changed accordinly.

 * app/base/base-enums.h
 * app/core/core-enums.h: removed pdp-skip for GimpInterpolationType
 and GimpTransformDirection enums.

 * libgimp/gimpenums.h
 * plug-ins/pygimp/gimpenums.py
 * tools/pdbgen/enums.pl
 * tools/pdbgen/groups.pl: regenerated.

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/pdb/drawable_transform.pdb: added new file defining
 the new PDB calls.

 * app/pdb/Makefile.am
 * app/pdb/drawable_transform_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/transform_tools_cmds.c
 * libgimp/gimp_pdb.h
 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * modules/controller_linux_input.c
 * modules/controller_midi.c: don't enter an infinite blocking loop
 when the user selects an input file that can be opened, but not
 read (like a directory).

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
 parameter "const gchar *select_action" and preselect the passed
 action if non-NULL. Made the column enum public to users of this
 widget can get data from its tree store.

 * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
 pass NULL because we don't want a preselected action here.

 * app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
 buttons to change the event -> action mapping. Implement a action
 chooser dialog using GimpActionView. Fixes bug #106920.

2004-10-26  Sven Neumann  <sven@gimp.org>

 * app/actions/channels-commands.c
 * app/core/gimpchannel-select.c
 * app/core/gimpimagefile.c
 * app/core/gimpundo.c
 * app/widgets/gimpcomponenteditor.c: use the new enum utility
 functions from libgimpbase instead of accessing enum_value->value_name.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/quit-dialog.c (quit_dialog_container_changed): when
 changing the button's label to "Quit", also make it the default
 action.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcontrollereditor.[ch]: new widget built from
 preliminary code from the prefs dialog. Prerequisite for finally
 fixing bug #106920.

 * app/dialogs/preferences-dialog.c: use the new widget.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific
 code a bit. Use gimp_drawable_mask_intersect().

2004-10-25  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for
 regexp group.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
 my last change removed the sanity check for array_length >= 0.
 Put it back.

2004-10-26  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimpbase.def: updated.

2004-10-25  DindinX  <dindinx@gimp.org>

 * plug-ins/common/retinex.c: added this new plug-in.
 Addresses bug #135594

 * plug-ins/common/plugin-defs.pl: modified accordingly.

 * plug-ins/common/.cvsignore
 * plug-ins/common/Makefile.am: regenerated.

 * plug-ins/gfig/gfig-arc.c
 * plug-ins/gfig/gfig-arc.h
 * plug-ins/gfig/gfig-circle.c
 * plug-ins/gfig/gfig-circle.h
 * plug-ins/gfig/gfig-dialog.c: smallish style cleanups

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
 silently accept arrays which are longer than specified. Nothing
 bad can happen and it's common practice to resize arrays in fixed
 size chunks so avoid frequent resizing. Fixes bug #155359.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/siod-wrapper.c (init_constants): removed
 debugging output i forgot.

2004-10-25  Sven Neumann  <sven@gimp.org>

 * app/dialogs/quit-dialog.c: change the action button's label to
 "Quit" if there are no images with unsaved changes.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimpbaseenums.[ch]: register some missing enums.

 * tools/pdbgen/enumcode.pl: removed code to generate 
 plug-ins/script-fu/script-fu-constants.c, generate code to
 explicitely initialize and query all of libgimp*'s enums
 and write it to libgimp/gimpenums.c.tail

 * libgimp/gimpenums.h: regenerated.

 * libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c

 * libgimp/gimp.c (gimp_main): call g_type_init() and
 _gimp_enums_init().

 * libgimp/gimp.def: added gimp_enums_get_type_names().

 * plug-ins/script-fu/Makefile.am
 * plug-ins/script-fu/script-fu-constants.[ch]: removed these files.

 * plug-ins/script-fu/siod-wrapper.c: dynamically register all
 constants using gimp_enums_get_type_names() and introspection.
 Also register the built-in unit types.

 * plug-ins/script-fu/script-fu.c: changed accordingly.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 Don't store human readable and translatable enum/flag strings in
 GEnumValue's and GTypeValue's fields but attach them to their
 GType using separate structs and utility functions:

 * tools/gimp-mkenums: added params and perl voodoo to support
 generating a second array of values, which is used by the
 Makefiles below to create and register arrays of value
 descriptions.

 * libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
 arrays of translatable strings to/from enum and flags types. Added
 structs GimpEnumDesc and GimpFlagsDesc for that purpose.

 * libgimpbase/gimputils.[ch]: changed existing enum utility
 functions, added new ones and added a symmetric API for flags.

 * app/base/Makefile.am
 * app/core/Makefile.am
 * app/display/Makefile.am
 * app/paint/Makefile.am
 * app/text/Makefile.am
 * app/tools/Makefile.am
 * app/widgets/Makefile.am
 * libgimp/Makefile.am
 * libgimpbase/Makefile.am: changed *-enums.c generation rules
 accordingly.

 * app/base/base-enums.c
 * app/core/core-enums.c
 * app/display/display-enums.c
 * app/paint/paint-enums.c
 * app/text/text-enums.c
 * app/tools/tools-enums.c
 * app/widgets/widgets-enums.c
 * libgimpbase/gimpbaseenums.c: regenerated.

 * app/widgets/gimpenumstore.c
 * app/widgets/gimpenumwidgets.c
 * app/widgets/gimptemplateeditor.c
 * libgimpwidgets/gimppreviewarea.c: follow the enum utility
 function API changes.

2004-10-25  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_cmd_gimp_guides.c
 * plug-ins/imagemap/imap_edit_area_info.c
 * plug-ins/imagemap/imap_main.c
 * plug-ins/imagemap/imap_menu.[ch]
 * plug-ins/imagemap/imap_menu_funcs.[ch]
 * plug-ins/imagemap/imap_misc.c
 * plug-ins/imagemap/imap_settings.c
 * plug-ins/imagemap/imap_source.c: added a menu entry for Help.
 Did more minor layout adjustments for HIG compliance.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not
 just gimputils.h

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * menus/toolbox-menu.xml.in: commented out the "Debug" submenu.
 Should do this via an xsltproc --param actually...

2004-10-25  DindinX  <dindinx@gimp.org>

 * plug-ins/common/newsprint.c: removed debugging g_print and
 remove my memory fix, since it was buggy and shouldn't be done.
 My fix just broke this plug-in (reported by Joao S. O. Bueno
 Calligaris)

2004-10-25  Simon Budig  <simon@gimp.org>

 * app/tools/gimpvectortool.c: Switch to design mode when
 Escape gets pressed. Untabbified.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * app/actions/gradient-editor-commands.c
 * app/display/gimpdisplayshell-preview.c: irrelevant coding style
 and spacing cleanups.

 * app/widgets/gimpimageeditor.c: removed utility function
 gimp_image_editor_context_changed() and connect
 gimp_image_editor_set_image() directly using
 g_signal_connect_swapped().

2004-10-25  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_circle.c
 * plug-ins/imagemap/imap_cmd_gimp_guides.c
 * plug-ins/imagemap/imap_cmd_guides.c
 * plug-ins/imagemap/imap_default_dialog.[ch]
 * plug-ins/imagemap/imap_edit_area_info.c
 * plug-ins/imagemap/imap_grid.c
 * plug-ins/imagemap/imap_main.c
 * plug-ins/imagemap/imap_misc.c
 * plug-ins/imagemap/imap_polygon.c
 * plug-ins/imagemap/imap_preferences.c
 * plug-ins/imagemap/imap_rectangle.c
 * plug-ins/imagemap/imap_selection.c
 * plug-ins/imagemap/imap_source.c
 * plug-ins/imagemap/imap_toolbar.c
 * plug-ins/imagemap/imap_tools.c: reviewed for HIG
 compliance. Various other minor fixes. Closes bug #150004.

2004-10-25 Kevin Cozens <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/test-sphere.scm: Added parameter
 missing from argument list.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/enumcode.pl
 * libgimp/Makefile.am: register all enums in libgimp/gimpenums.h
 with the type system.

 * libgimp/gimpenums.h: regenerated.

 * libgimp/gimp.def: updated.

2004-10-25  Sven Neumann  <sven@gimp.org>

 * configure.in: gimp_user_version should be 2.2.

 * libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup.

2004-10-25  Sven Neumann  <sven@gimp.org>

 * configure.in:
 * app/Makefile.am
 * tools/Makefile.am: bumped version to 2.2.0-pre1, set app version
 to 2.2, reset other versions to 2.0. Changed library versioning so
 we install with the same soname as gimp-2.0 again.

2004-10-25  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say
 "Click to create preview" if no preview is available.

2004-10-25  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
 which saves a GtkTextBuffer's contents to a file.

 * app/widgets/gimperrorconsole.c: use
 gimp_editor_add_action_button() and removed all "clicked"
 callbacks, including all file saving code.

 * app/actions/error-console-actions.c
 * app/actions/error-console-commands.[ch]: added the code removed
 above to the action callbacks. Use gimp_text_buffer_save().

2004-10-24  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpgradienteditor.[ch]
 * app/widgets/gimppaletteeditor.[ch]: added public APIs for
 zooming the editors. Use gimp_editor_add_action_button() to create
 all buttons. Removed all button callbacks and all duplicated
 button sensitivity logic.

 * app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
 the editor's UI manager if it exists.

 * app/actions/gradient-editor-actions.c
 * app/actions/gradient-editor-commands.[ch]: added zoom actions
 and callback and call gimp_gradient_editor_zoom(). Fixed
 gradient_editor_actions_update() to actually set all items'
 sensitivity (it was possible to modify read-only gradients and
 even to crash GIMP).

 * app/actions/palette-editor-actions.c
 * app/actions/palette-editor-commands.[ch]: changed "new" and
 "zoom" actions to actually do their job instead of calling
 gtk_button_clicked(editor->foo_button).

2004-10-24  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
 dialog callbacks and use gimp_editor_add_action_button() for
 the edit button. Removed button sensitivity logic. Hide the
 color dialog when the image's mode changes.

 * app/actions/colormap-editor-actions.c: added missing tooltip
 for the edit action.

 * app/actions/colormap-editor-commands.c: implement the dialog
 here.

2004-10-24  DindinX  <dindinx@gimp.org>

 * app/core/gimpdrawable-desaturate.c: only return early if there's
 nothing to desaturate.

2004-10-24  Michael Natterer  <mitch@gimp.org>

 * app/actions/vectors-commands.c: don't leak the filenames of the
 import and export dialogs.

2004-10-24  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/vectors-export-dialog.[ch]
 * app/dialogs/vectors-import-dialog.[ch]: new files.

 * app/actions/vectors-commands.c: use the new dialogs and remember
 their last values.

2004-10-23  Sven Neumann  <sven@gimp.org>

 * app/actions/vectors-commands.c: added missing controls to the
 path import and export dialogs.

2004-10-23  DindinX  <dindinx@gimp.org>

 * plug-ins/common/newsprint.c: cleaned it up, fixed a (documented)
 memory leak and the weird behaviour of the resolution scales.

2004-10-23  DindinX  <dindinx@gimp.org>

 * plug-ins/common/newsprint.c: added a preview.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpaspectpreview.h
 * libgimp/gimpdrawablepreview.h
 * libgimp/gimpprogressbar.h
 * libgimpwidgets/gimpcellrenderercolor.h
 * libgimpwidgets/gimpcellrenderertoggle.h
 * libgimpwidgets/gimpframe.h
 * libgimpwidgets/gimpintcombobox.h
 * libgimpwidgets/gimpintstore.h
 * libgimpwidgets/gimppreview.h
 * libgimpwidgets/gimppreviewarea.h
 * libgimpwidgets/gimpscrolledpreview.h: added padding to all class
 structs which have been added since 2.0.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-commands.c (file_save_cmd_callback): don't
 g_return_if_fail() if there is no active drawable, just silently
 return.

 * app/actions/image-commands.c: remember the last merge_type of
 the "Merge Visible Layers" dialog.

 * app/actions/layers-commands.c: remeber the last values of the
 "Add Layer Mask" dialog.

 * app/actions/select-commands.c: renamed a bunch of static
 variables to be consistent with other variables used to remember
 dialog values.

 * app/actions/view-commands.c (view_fullscreen_cmd_callback): it's
 useless to update the "view-fullscreen" actions here because the
 "fullscreen" state of the shell changes asynchronously

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/image-merge-layers-dialog.c
 * app/dialogs/layer-add-mask-dialog.c: made them not resizable.

 * app/dialogs/convert-dialog.c
 * app/dialogs/offset-dialog.c: renamed ugly variables.

 * app/dialogs/image-new-dialog.c
 * app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split
 out of actions/.

 * app/actions/image-commands.c: removed it here. Some cleanup.

2004-10-23  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumb-utils.[ch]
 * libgimpthumb/gimpthumbnail.[ch]
 * libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
 thumbnails.

 * app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
 failure thumbnail if one exists. Unless the thumbnail was created
 explicitely, remove all other thumbnails for this image.

 * app/actions/documents-commands.c: changed accordingly.

 * app/file/file-open.c: only save a thumbnail if there isn't a
 valid thumbnail already.

 * app/widgets/gimpthumbbox.c: before attempting to create a new
 thumbnail, check if there's an uptodate failure thumbnail.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split
 out of actions/.

 * app/actions/layers-commands.c: removed it here. Some cleanup.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * autogen.sh: don't tell nonsense by printing "I am going to run
 ./configure with no arguments", because we always pass at least
 --enable-maintainer-mode. Instead, simply always print all
 arguments. Also removed --copy from the calls to glib-gettextize
 and intltoolize.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
 SLEECTION_STROKE and PATH_STROKE stock items so they can be used
 in action areas.

 * app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
 with "_Stroke" and reordered some code.

 * app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
 of GTK_STOCK_OK. Added parameters to specify the dialog's title
 so it doesn't say "Stroke Options".

 * app/actions/select-commands.c
 * app/actions/vectors-commands.c
 * app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
 Path" as dialog titles.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 When there are variants of actions with and without dialog, let
 the dialog-less actions try to use the values from the last dialog
 invocation:

 * app/actions/channels-actions.c
 * app/actions/channels-commands.[ch]
 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]
 * app/actions/vectors-actions.c
 * app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
 actions to foo-new-last-values and use the last values entered in
 the dialogs.

 * app/widgets/gimpchanneltreeview.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimpvectorstreeview.c: changed accordingly. Show
 the dialog on clicking "New" and call the last-values action on
 <shift>+click.

 * app/actions/select-actions.c
 * app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
 to -last-values.

 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimpvectorstreeview.c: stroke with last values on
 <shift> clicking the stroke buttons.

2004-10-23  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a
 temporary file to avoid problems with concurrent thumbnail
 creation.

2004-10-23  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog.

 * app/actions/layers-commands.c: use it here.

2004-10-22  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpimagemaptool.[ch]
 * app/tools/gimpcurvestool.c
 * app/tools/gimplevelstool.c: allow to Shift-click the Load and
 Save buttons to skip the file chooser dialog and reuse the last
 used filename. Fixes bug #75558.

2004-10-22  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/template-options-dialog.[ch]: the new/edit template
 dialog.

 * app/actions/templates-commands.c: removed the code here and use
 template_options_dialog_new(). Removed utility functions. Some
 cleanup.

2004-10-22  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
 sure the button_box is always interted at the very bottom of the
 editor.

 * app/widgets/gimpviewabledialog.c: changed the "description"
 property from CONSTRUCT_ONLY to CONSTRUCT.

 * app/widgets/gimpcolormapeditor.c: show the index of the edited
 color in the color dialog and use the correct icon. Replaced label
 "Hex triplet" by "HTML notation" to be consistent with the color
 dialog. Removed wrong 2 pixel border around the table below the
 preview.

2004-10-22  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/wmf.c: fixed non-interactive call with default
 values.

2004-10-22  Sven Neumann  <sven@gimp.org>

 * app/actions/colormap-editor-actions.c
 * app/actions/dialogs-actions.c
 * app/core/gimpimage-colormap.c
 * app/dialogs/convert-dialog.c
 * app/dialogs/dialogs.c
 * app/widgets/gimpcolormapeditor.c: use the term "Colormap"
 instead of "Indexed Palette". Fixes bug #155829.

2004-10-22  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/wmf.c: applied a patch by Karine Proot that adds
 a preview to the load dialog and a similar UI as the SVG loader.
 Fixes bug #133519 and bug #133521.

2004-10-22  Michael Natterer  <mitch@gimp.org>

 * app/core/core-enums.[ch]: added new enum GimpStrokeMethod which
 can be one of { LIBART, PAINT_CORE }.

 * app/core/Makefile.am
 * app/core/core-types.h
 * app/core/gimpstrokedesc.[ch]: new object which encapsulates
 the params and setup logic for the different stroke methods.

 * app/core/gimpitem.[ch]: use it in GimpItem::stroke() and
 in the gimp_item_stroke() wrapper.

 * app/core/gimpchannel.c (gimp_channel_stroke)
 * app/core/gimpselection.c (gimp_selection_stroke)
 * app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly.

 * app/actions/select-commands.c
 * app/actions/vectors-commands.c
 * app/dialogs/stroke-dialog.c
 * tools/pdbgen/pdb/edit.pdb
 * tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the
 code quite a bit.

 * app/pdb/edit_cmds.c
 * app/pdb/paths_cmds.c: regenerated.

2004-10-22  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppropwidgets.c: remember the param_spec with each
 radio button instead of with the box/frame around them.

2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/script-fu.c: Removed _() tag from two strings
 that should not have been marked for translation.

2004-10-21  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts-fu.c: Fixed spelling error.

2004-10-21  Michael Natterer  <mitch@gimp.org>

 * app/actions/select-actions.c
 * app/actions/select-commands.[ch]
 * app/actions/vectors-actions.c
 * app/actions/vectors-commands.[ch]: added actions and callbacks
 to stroke with the last values used without showing the stroke
 dialog. The actions have no menu entries but can be called via
 shortcuts. Fixes bug #135746.

 (Disclaimer: the uglyness of the callbacks shows the need for a
 stroke API overhaul).

2004-10-20  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-stroke.c
 (gimp_drawable_stroke_scan_convert): Replacing the call to
 gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect()
 was wrong because gimp_channel_is_empty() makes sure that the
 selection doesn't mask itself while being stroked.

2004-10-20  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/raw.c: ported to GimpPreviewArea.

2004-10-20  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/raw.c: new plug-in from Tim Copperfield, made
 work with the GIMP 2.1 API by Philipp Gühring, then heavily
 cleaned up and undeprecated by myself. Fixes bug #144943.
 
 (still uses GtkPreview, but i wanted a sane state in cvs to diff
  against before replacing it)

 * plug-ins/common/plugin-defs.pl: changed accordingly.

 * plug-ins/common/Makefile.am: regenerated.

2004-10-20  Michael Natterer  <mitch@gimp.org>

 Fixed bug #155733 for libgimp:

 * tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect()
 to the PDB and improved documentation for drawable_mask_bounds().

 * app/pdb/drawable_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpdrawable_pdb.[ch]: regenerated.

 * libgimp/gimp.def: changed accordingly.

2004-10-20  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect()
 which returns the same bounding box as gimp_drawable_mask_bounds(),
 but returns TRUE only if there is a non-empty intersection between
 the drawable and the selection, or no selection at all. It also
 returns the intersection as x,y,width,height instead of the
 eeky x1,y1,x2,y2.

 * app/core/gimp-edit.c
 * app/core/gimpdrawable-blend.c
 * app/core/gimpdrawable-bucket-fill.c
 * app/core/gimpdrawable-desaturate.c
 * app/core/gimpdrawable-equalize.c
 * app/core/gimpdrawable-histogram.c
 * app/core/gimpdrawable-invert.c
 * app/core/gimpdrawable-stroke.c
 * app/core/gimpimagemap.c
 * app/core/gimpselection.c
 * tools/pdbgen/pdb/color.pdb
 * tools/pdbgen/pdb/transform_tools.pdb: either switch from
 gimp_drawable_mask_bounds() to _intersect() or check the return
 values of _mask_bounds() manually to avoid operations on empty
 areas. Return successfully because it's a nop, not a failure.
 Fixes bug #155733 for the core.

 * app/pdb/color_cmds.c
 * app/pdb/transform_tools_cmds.c: regenerated.

2004-10-19  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptextoptions.c (gimp_text_options_gui): removed
 3 mnemonics. No other tool options label has a mnemonic.
 Addresses bug #155861.

2004-10-19  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/vectors-options-dialog.[ch]: one more dialog split
 out of actions/.

 * app/actions/vectors-commands.c: removed it here. Merged more
 utility functions into their only callers.

 * app/actions/dockable-commands.c
 * app/actions/edit-commands.c
 * app/actions/file-commands.c
 * app/actions/palettes-commands.c
 * app/actions/tool-options-commands.c
 * app/actions/view-commands.c: renamed "qbox" and "query_box"
 variables to "dialog".

2004-10-19  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/screenshot.c (shoot_dialog): don't forget to set
 the mnemonic widgets for the labels. Fixes bug #155811.

2004-10-19  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/channel-options-dialog.[ch]: new files implementing
 the channel options dialog with a horrid number of 13 construction
 parameters. Still better than having the same code twice, only
 differing in strings used...

 * app/actions/channels-commands.c
 * app/actions/qmask-commands.c: removed the dialog code here and
 use channel_options_dialog_new().

2004-10-19  Jay Cox  <jaycox@gimp.org>

 * plug-ins/common/psd_save.c: don't try to save psd files that are
 larger than 30000 pixels in either direction.  Fixed the rle code
 to compress more compactly.  Fixed a memmory leak in
 save_channel_data.

2004-10-18  Michael Natterer  <mitch@gimp.org>

 Action code review and pre-release consistency cleanup:

 * app/actions/*-actions.c: added some missing and resolved
 conflicting mnemonics, added missing help IDs. Cleaned up the
 *_actions_update() functions.

 * app/actions/channels-actions.c
 * app/actions/layers-actions.c
 * app/actions/vectors-actions.c (*_actions_update): simplified
 the code that figures the prev and next channel,layer,vectors.

 * app/actions/qmask-actions.c: use the same accelerator for
 "qmask-active" and "qmask-toggle". Fixed action sensitivity.

 * app/actions/channels-commands.c
 * app/actions/dockable-commands.c
 * app/actions/documents-commands.c
 * app/actions/gradients-commands.c
 * app/actions/layers-commands.c
 * app/actions/palettes-commands.c
 * app/actions/image-commands.c
 * app/actions/select-commands.c
 * app/actions/vectors-commands.c: folded tons of private utility
 functions into their only callers (they used to be public and
 called from outside before the switch to action based menus).
 Renamed functions and variables saying "query" or "qbox" to
 "dialog". Moved static functions to the end of the files. Misc
 minor cleanups.

 * app/actions/drawable-actions.c
 * app/actions/drawable-commands.c: made the "drawable-visible" and
 "drawable-linked" actions affect the layer if the active drawable
 is a layer mask.

 * app/actions/select-commands.c: added action to stroke with the
 last values used in an attempt to address bug #135746 but #if 0'ed
 it because the approach is too ugly.

 * app/tools/gimpiscissorstool.c: changed mnemonic from I to S.

 * menus/image-menu-xml.in: added more stuff to the (commented out)
 "context" menu.

2004-10-17  DindinX  <dindinx@gimp.org>

 * libgimp/gimppixelrgn.c: some more clues in the documentation
 (suggested by nomis)

2004-10-17  DindinX  <dindinx@gimp.org>

 * libgimp/gimppixelrgn.c: clarify some usecases for
 gimp_pixel_rgn_init().

2004-10-17  DindinX  <dindinx@gimp.org>

 * plug-ins/common/colortoalpha.c: Added a preview.

2004-10-17  DindinX  <dindinx@gimp.org>

 * plug-ins/common/glasstile.c: use a GimpDrawablePreview.

2004-10-17  DindinX  <dindinx@gimp.org>

 * plug-ins/common/borderaverage.c: smallish cleanups.

2004-10-17  DindinX  <dindinx@gimp.org>

 * plug-ins/common/displace.c: Added a preview and minor cleanups.
 Can someone provide useful testcases for this plug-in?

2004-10-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
 "signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
 Removed them from gimp_item_tree_view_new(). Require the view_type
 instead of item_type in gimp_item_tree_view_new().

 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimpdrawabletreeview.c (get_type): made them
 abstract base classes.

 * app/widgets/gimpchanneltreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimpvectorstreeview.c (class_init): set the
 item_type and signal_name members if GimpItemTreeViewClass.

 * app/dialogs/dialogs-constructors.c: changed accordingly.

2004-10-16  Manish Singh  <yosh@gimp.org>

 * autogen.sh: Add support for automake 1.9. Also rm autom4te.cache,
 since it might interfere with differing autoconf versions.

2004-10-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpuimanager.[ch]: added utility function
 gimp_ui_manager_get_action() which takes "group_name" and
 "action_name".

 * app/display/gimpdisplayshell-close.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimptoolbox.c
 * app/widgets/gimptooloptionseditor.c: use it.

2004-10-16  Michael Natterer  <mitch@gimp.org>

 * app/actions/channels-actions.c
 * app/actions/colormap-editor-actions.c
 * app/actions/documents-actions.c
 * app/actions/tool-options-actions.c
 * app/actions/vectors-actions.c: added more tooltips for actions
 which are used as extended dialog button callbacks.

 * app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
 the list of extended actions in reverse order.

 * app/widgets/gimpchanneltreeview.c
 * app/widgets/gimpcolormapeditor.c
 * app/widgets/gimpdocumentview.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimptooloptionseditor.c
 * app/widgets/gimpvectorstreeview.c: don't set the tooltips
 manually. Removes another bunch of insane translatable multiline
 format strings. Pass the extended actions in the right order
 to gimp_editor_add_action_button().

2004-10-16  Michael Natterer  <mitch@gimp.org>

 * app/actions/vectors-commands.c (vectors_linked_cmd_callback):
 call gimp_item_set_linked(), not gimp_item_set_visible().
 Fixes bug #155578

2004-10-16  Michael Natterer  <mitch@gimp.org>

 Ported the layers, channels and paths dialogs from
 gimp_editor_add_button() to gimp_editor_add_action_button(),
 removing a massive amount of duplicated code, sensitivity logic
 and confusing utility functions.

 * app/actions/channels-actions.c
 * app/actions/channels-commands.[ch]
 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]
 * app/actions/vectors-actions.c
 * app/actions/vectors-commands.[ch]: added "foo-new-default"
 actions and callbacks which create items without a dialog,
 optionally using default values from a passed template. Removed
 all public utility function that were passed as function pointers
 to widget construtors. Added tooltips to all actions which are now
 used for dialog buttons.

 * app/widgets/gimpeditor.c (gimp_editor_add_action_button):
 automatically create multi-line tooltips showing the modifiers for
 extended action buttons. Removes the need for lots of insane
 format strings that need to be translated correctly.

 * app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
 replaced tooltip and help_id strings by action names.

 (struct GimpItemTreeView)
 (gimp_item_tree_view_new): removed "edit", "new" and "activate"
 function pointers.

 (gimp_item_tree_view_constructor): create all buttons
 with gimp_editor_add_action_button(), using the action names
 from GimpItemTreeViewClass.

 Removed tons of "clicked" callbacks and all code which sets the
 buttons' sensitivity. They are not needed any longer.

 Require all subclasses to implement GimpItemTreeView::new_item(),
 a new virtual function which creates a plain new item without
 showing a dialog.

 * app/widgets/gimpdrawabletreeview.c
 * app/widgets/gimpchanneltreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimpvectorstreeview.c: fill in the action names and
 implement GimpItemTreeView::new_item(). Removed all button
 sensitivity logic.

 * app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
 include anything from actions/ any more.

2004-10-15  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for
 layer_add_mask() and layer_remove_mask().

 * app/pdb/layer_cmds.c
 * libgimp/gimplayer_pdb.c: regenerated.

2004-10-15  Michael Natterer  <mitch@gimp.org>

 * app/actions/images-commands.[ch]
 * app/actions/templates-commands.[ch]: made some public functions
 private or removed them entirely by folding their code into their
 callers. They used to be passed as function pointers to widgets in
 the pre action-based dialog buttons era.

2004-10-15  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/quit-dialog.c: raise the image's displays on
 double-click in the dirty image list.

2004-10-15  Michael Natterer  <mitch@gimp.org>

 Fixed bug #155328:

 * app/actions/vectors-actions.c (vectors_actions_update): don't
 set the "selection to path" actions sensitive if there is no
 image.

 * app/widgets/gimpitemtreeview.c: update the UI manager after
 setting the view's image. Connect to GimpImage::flush() and
 update the UI manager in the callback, too.

2004-10-15  Michael Natterer  <mitch@gimp.org>

 * app/actions/view-actions.c (view_zoom_actions): removed
 duplicate "view-zoom-in" action (cut'n'paste error) and fixed the
 swapped "zoom in/out a lot" actions. Fixes bug #155446.

2004-10-15  Sven Neumann  <sven@gimp.org>

 * Made 2.1.7 release.

2004-10-15  Sven Neumann  <sven@gimp.org>

 * app/tools/gimptransformoptions.c: removed the "Density" label.
 It wasn't helpful and caused the transform options to be wider than
 necessary.

 * app/tools/gimpblendoptions.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimptransformoptions.c: let combo boxes expand
 horizontally like we do in other (all?) dialogs.

 * app/widgets/gimptemplateeditor.c
 (gimp_template_editor_aspect_callback): update the pixel size label.

2004-10-15  Sven Neumann  <sven@gimp.org>

 * data/images/gimp-splash.png: new splash by Jimmac.

2004-10-15  DindinX  <dindinx@gimp.org>

 * plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and
 removed many lines of codes.

2004-10-14  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script.
 (Related to bug #153900 and compatability with Tiny-Fu)

2004-10-14  DindinX  <dindinx@gimp.org>

 * plug-ins/common/neon.c: fixed the handling of drawable with alpha.

2004-10-14  DindinX  <dindinx@gimp.org>

 * plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the
 previous preview was absolutely useless. Done some cleanups, too.

 * plug-ins/common/spread.c: remember the preview state between
 invocations.

2004-10-14  DindinX  <dindinx@gimp.org>

 * plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a
 GimpAspectPreview, since this plug-in is somewhat edge-oriented and
 this makes the code simpler ;)

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * themes/Default/images/stock-gradient-bilinear-16.png
 * themes/Default/images/stock-gradient-linear-16.png: rotate them
 by 90 degrees. All our gradient previews and icons go left->right,
 not top->bottom.

2004-10-14  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/bmpread.c: Make sure we have a bpp value we can
 handle, and fail gracefully if not. Fixes bug #155401.

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpwidgets.c
 * app/widgets/gimpenumwidgets.[ch]
 * app/widgets/gimppropwidgets.c
 * app/actions/layers-commands.c
 * app/dialogs/convert-dialog.c
 * app/tools/gimpblendoptions.c
 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimpcolorbalancetool.c
 * app/tools/gimpcolorizetool.c
 * app/tools/gimpcoloroptions.c
 * app/tools/gimpcurvestool.c
 * app/tools/gimphuesaturationtool.c
 * app/tools/gimpinkoptions-gui.c
 * app/tools/gimplevelstool.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimpselectionoptions.c
 * app/tools/gimptransformoptions.c: the child of a GimpFrame must
 not have any border width. Fixes many subtle misalignments.

2004-10-14  Sven Neumann  <sven@gimp.org>

 * app/core/gimpprogress.[ch]: added "message" function to the
 GimpProgress interface. Call gimp_message() if it is unimplemented.

 * app/plug-in/plug-in-progress.[ch]: added new function
 plug_in_progress_message() that passes the message to the current
 proc_frame's progress.

 * app/widgets/gimpthumbbox.c: implement GimpProgress::message.
 Just do nothing in the implementation. We don't want to see
 messages from file plug-ins that we use to create the thumbnails.

 * tools/pdbgen/pdb/message.pdb
 * app/pdb/message_cmds.c: if there's a current plug-in, dispatch
 the message by calling plug_in_progress_message().

 * app/display/gimpdisplayshell-close.c: fixed wrong types in
 function calls.

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
 GIMP_HELP_COLOR_DIALOG as help_id.

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * app/actions/dialogs-commands.c: purely cosmetic.

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * app/core/core-enums.[ch]: register GimpConvertPaletteType with
 the type system.

 * tools/pdbgen/enums.pl: regenerated.

 * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
 fixed to insert the widget at the right place in the radio box.

 * app/dialogs/convert-dialog.c: use enum widgets and
 gimp_enum_radio_frame_add(), resulting in a much better looking
 dialog with much less lines of code.

2004-10-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index".
 "Home" is misleading and leads to problems in some locales (see
 bug #148120).

2004-10-14  Michael Natterer  <mitch@gimp.org>

 * tools/authorsgen/contributors: correct UTF-8 spelling of
 João S. O. Bueno Calligaris.

 * AUTHORS
 * app/dialogs/authors.h: regenerated.

2004-10-14  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of
 script on original layer.  (bug #155358)  Fixed spelling error.

2004-10-13  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/Makefile.am: Remove stamp files during
 maintainer-clean. Addresses bug #155357. Also flesh out the
 dependencies some so rebuilds get triggered when all their
 dependent files change.

2004-10-14  Sven Neumann  <sven@gimp.org>

 * app/actions/file-commands.c (file_revert_cmd_callback): creata
 an UTF-8 filename from the image URI and display that instead of
 the URI.

 * app/dialogs/convert-dialog.c (convert_dialog_new): removed the
 palette size warning for transparent images. The number of colors
 is already adjusted to 255. This text was IMO more frightening
 than helpful.

2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/add-bevel.scm: two variables were
 not defined before first use (bug #153900).

2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>

 * app/widgets/gimpactionview.c: Fixed a spelling error.

2004-10-13  DindinX  <dindinx@gimp.org>

 * plug-ins/common/colorify.c: Added a preview.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c: removed trailing whitespace.

 * libgimpwidgets/gimpwidgets.def: added
 gimp_preview_set_default_cursor.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpmessagedialog.c: improved handling of parent
 widget; probably just being paranoid here.

 * app/actions/image-commands.c
 * app/dialogs/image-new-dialog.c: ported memory size confirmation
 dialogs to GimpMessageDialog.

2004-10-13  DindinX  <dindinx@gimp.org>

 * libgimpwidgets/gimppreview.[ch]: added a new function to set the
 default cursor on preview: gimp_preview_set_default_cursor().

 * libgimpwidgets/gimpscrolledpreview.c: changed accordlingly.

 * plug-ins/common/flarefx.c:
 * plug-ins/common/nova.c: use this function.

 This addresses bug #90519.

2004-10-13  DindinX  <dindinx@gimp.org>

 * plug-ins/common/cubism.c: Added a preview and done some cleanups.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/actions/plug-in-commands.c
 * app/actions/templates-commands.c
 * app/actions/tool-options-commands.c: ported more boolean queries
 to GimpMessageDialog.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpmessagedialog.c: handle parent widget not being
 a GtkWindow by calling gtk_widget_get_toplevel().

 * app/actions/data-commands.c
 * app/actions/edit-commands.c
 * app/actions/file-commands.c: ported more boolean queries to
 GimpMessageDialog.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpmessagedialog.[ch]: added a simple message
 dialog to avoid code duplication.

 * app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

 * app/dialogs/file-save-dialog.c
 * app/dialogs/quit-dialog.c
 * app/display/gimpdisplayshell-close.c
 * app/widgets/gimperrordialog.c
 * app/widgets/gimphelp.c
 * app/widgets/gimpactionview.c: use the new GimpMessageDialog.

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * app/actions/image-actions.c
 * menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides".

 * plug-ins/script-fu/scripts/Makefile.am
 * plug-ins/script-fu/scripts/guides-from-selection.scm
 * plug-ins/script-fu/scripts/guides-new-percent.scm
 * plug-ins/script-fu/scripts/guides-new.scm
 * plug-ins/script-fu/scripts/guides-remove-all.scm: added new
 scripts from Alan Horkan. Fixes bug #119667.

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/flarefx.c: cleaned up and simplified the
 FlareCenter code even more.

 * plug-ins/common/nova.c: did the same changes for the NovaCenter
 stuff.

 Also added code which sets an appropriate cursor on "realize" to
 fix bug #90519, but GimpPreview currently prevents this from
 working correctly...

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/widgets-enums.[ch]: changed the description for
 GIMP_HELP_BROWSER_GIMP.

 * app/dialogs/file-save-dialog.c:
 * app/widgets/gimphelp.c: use a GimpDialog embedding a
 GimpMessageBox instead of gimp_query_boolean_box which looks
 somewhat old fashioned.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp.c: improved error messages on missing help
 browser plug-in.

 * libgimpthumb/gimpthumb-utils.c
 * libgimpthumb/gimpthumbnail.c: improved documentation.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-close.c
 (gimp_display_shell_close_dialog): changed button label.

2004-10-12  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of
 script used in second register line.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-close.c: changed rounding.

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/image-new-dialog.c (image_new_response): don't
 forget to reset the template combo on RESPONSE_RESET.

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplay-foreach.c: keep the container of dirty
 images up to date.

 * app/dialogs/quit-dialog.c: fixed model/view behavior here, too.

 (both are still far from perfect)

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-close.c
 (gimp_display_shell_close_dialog): keep the time uptodate.

2004-10-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
 the imagefile while creating the thumbnail.

 * app/core/gimpimagefile.[ch]
 * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
 the tricky part about thumbnail creation into the new function
 gimp_imagefile_create_thumbnail_weak().

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from
 gimp_plugin_menu_register().

2004-10-13  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/preferences-dialog.c (prefs_dialog_new): added
 missing and resolved conflicting mnemonics.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: moved out of the
 "Modify" placeholder. Using placeholders from Script-Fu breaks
 i18n.  We will need to change menu registration for scripts but
 this will have to wait..

2004-10-12  Michael Natterer  <mitch@gimp.org>

 * plug-ins/*/*.c: all plug-ins except script-fu: removed the
 translation marks from the menu paths passed to
 gimp_plugin_menu_register(). All default menu branches used by
 included plug-ins are created and translated by the core now.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimage.[ch]: renamed struct member "unit" to
 "resolution_unit".

 * app/actions/image-commands.c
 * app/core/gimp-edit.c
 * app/core/gimpimage-duplicate.c
 * app/core/gimpimage-undo-push.c
 * app/dialogs/info-window.c
 * app/vectors/gimpvectors-export.c
 * app/widgets/gimptoolbox-dnd.c:
 * app/xcf/xcf-load.c
 * app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
 where appropriate.

 * app/core/gimptemplate.c (gimp_template_set_from_image): fixed
 unit handling. Don't touch the template unit, it is used as the
 initial display unit. This will need further changes...

2004-10-12  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
 need to pack the widget expanding. Fixes pattern container
 entries.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/dialogs/info-window.[ch]: fixed unit handling. Right-align
 the labels displaying the cursor position. Renamed the "Extended"
 tab to "Cursor". Renamed the API accordingly.

 * app/display/gimpdisplayshell-cursor.c: changed accordingly.

2004-10-12  Michael Natterer  <mitch@gimp.org>

 * app/actions/drawable-commands.c (drawable_rotate_cmd_callback):
 if the drawable is a channel, pass clip_result as FALSE. Need to
 do this here for rotating only because it can't be decided
 generically in GimpChannel. Fixes crash when rotating channels
 or layer masks.

 Use the undo_desc from GimpItemClass instead of passing "Flip
 Layer" and "Rotate Layer".

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/file/file-open.c: minor cleanup.

 * app/file/file-save.c (file_save_as): no need to fiddle with the
 image name, the URI is taken from the imagefile anyway.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/actions/layers-actions.c (layers_actions_update): set
 "layers-crop" insensitive if the selection is empty.

 * plug-ins/script-fu/scripts/alien-glow-button.scm
 * plug-ins/script-fu/scripts/alien-glow-logo.scm
 * plug-ins/script-fu/scripts/basic2-logo.scm
 * plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans
 Bold" instead of "Futura_Poster". The underscore in the font name
 used to confuse intltool (bug #137029) and the freefont package
 isn't that widely used any longer anyway.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

 * app/widgets/gimppropwidgets.c: the order of setting the X and Y
 properties does matter.

 * app/dialogs/Makefile.am
 * app/dialogs/scale-dialog.[ch]: added first version of a new
 Scale dialog in an attempt to address bug #151022.

 * app/actions/layers-commands.c: use the new scale dialog.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.c: added mnemonics for the size
 entries.

2004-10-12  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
 instead of simply using the passed widget as mnemonic_widget for
 the GtkLabel, call the new utility function find_mnemonic_widget()
 which recursively searches the passed widget until it finds one
 that actually can be mnemonic-activated. Fixes lots of mnemonics
 where the attached widget is e.g. a GtkEventBox or GtkComboBox.

2004-10-12  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptooloptions-gui.[ch]: removed the recently added
 utility functions again.

 * app/widgets/Makefile.am
 * app/widgets/gimpviewablebox.[ch]
 * app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
 versions here.

 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimpclonetool.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimptextoptions.c: changed accordingly.

 * app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
 of reinventing the wheel.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
 icon size for GimpImagefile views.

 * themes/Default/images/stock-frame-64.png: removed the 1 pixel
 wide empty border around the frame.

 * app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the
 configure options that are needed to run 'make dist'.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.c: tweaked table spacings to get
 the Height label aligned with the entry again.

2004-10-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
 the "skip_taskbar_hint" and "skip_pager_hint" properties on the
 progress window.

2004-10-11  Manish Singh  <yosh@gimp.org>

 * plug-ins/fp/fp.c: Moved from here...

 * plug-ins/common/fp.c: ... to here.

 * plug-ins/common/plugin-defs.pl: changed accordingly.

 * plug-ins/common/.cvsignore
 * plug-ins/common/Makefile.am: regenerated.

 * configure.in
 * plug-ins/Makefile.am
 * plug-ins/fp: Removed directory.

2004-10-11  DindinX  <dindinx@gimp.org>

 * plug-ins/common/jigsaw.c: ported to GimpAspectPreview.

2004-10-11  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying
 the flare center. Fixed flare center dragging. Lots of cleanup.

2004-10-11  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/dialogs-types.h: removed ColorDialog typedef.

2004-10-11  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptooloptions-gui.[ch]: added utility functions
 which create a GimpViewableButton+GimpContainerEntry combo for
 brushes, patterns, gradients and fonts and a very ugly utility
 function which packs one of these combos into a GtkFrame returned
 by gimp_prop_enum_radio_frame_new(). This stuff does not really
 belong here but is too ugly to be moved to a more general place.

 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimptextoptions.c: use the new utility functions. Moved
 the pattern previews into the radio frame where using the pattern
 is selected. Make them insensitive if using the pattern is not
 selected.

2004-10-11  Sven Neumann  <sven@gimp.org>

 * app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs.

 * app/dialogs/preferences-dialog.c: group the thumbnail related
 controls together. Could probably still be improved...

2004-10-11  Sven Neumann  <sven@gimp.org>

 * app/actions/documents-commands.c
 (documents_recreate_preview_cmd_callback): when recreating the
 thumbnail, delete old thumbnails and create it in the configured
 thumbnail size instead of the container view preview size.

 * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb):
 reset the image info when the thumbnail state changes.

2004-10-11  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c: construct a case-insensitive glob
 pattern to use when filtering for file extensions.

2004-10-11  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
 user-visible counting starts at 1, not 0.

2004-10-11  Michael Natterer  <mitch@gimp.org>

 * tools/authorsgen/contributors: added missing contributors.
 Thanks to Kevin Cozens for going through ChangeLog and making a list.

 * AUTHORS
 * app/dialogs/authors.h: regenerated.

2004-10-11  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug
 output again.

2004-10-11  Sven Neumann  <sven@gimp.org>

 * app/batch.c: clarified.

2004-10-08  Kevin Cozens  <kcozens@cvs.gimp.org>

 * configure.in: removed duplicate GETTEXT_PACKAGE line.

2004-10-11  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumb-utils.[ch]
 * libgimpthumb/gimpthumb.def: added an API to delete thumbnails.

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
 when recreating a thumbnail on user request, delete all existing
 thumbnails for it.

 * plug-ins/common/AlienMap2.c: removed unused variable.

2004-10-10  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumb-utils.[ch]
 * libgimpthumb/gimpthumb.def
 * libgimpthumb/gimpthumbnail.c: added support for local thumbnails
 as introduced by version 0.7 of the thumbnail spec. Untested, but
 at least the API is there.

2004-10-10  DindinX  <dindinx@gimp.org>

 * plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some
 minor cleanups.

2004-10-10  DindinX  <dindinx@gimp.org>

 * plug-ins/common/vpropagate.c: added a preview.

2004-10-10  DindinX  <dindinx@gimp.org>

 * plug-ins/common/flarefx.c
 * plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview.

2004-10-10  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
 handle NULL as viewable parameter as a workaround for bug #149906.

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
 the code more robust.

 * app/xcf/xcf-private.h
 * app/xcf/xcf.c: added a const qualifier.

2004-10-09  DindinX  <dindinx@gimp.org>

 * app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard.

2004-10-09  Sven Neumann  <sven@gimp.org>

 * AUTHORS
 * app/dialogs/authors.h: regenerated. Someone should look into
 updating the list of contributors for the 2.2 release ...

2004-10-08  Kevin Cozens  <kcozens@cvs.gimp.org>

 * tools/authorsgen/contributors: Added my name to the
 list of contributors.

2004-10-08  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpthumbbox.c: tweaked the text shown while
 updating the preview so that the dialog doesn't need to resize.

2004-10-08  Sven Neumann  <sven@gimp.org>

 * app/config/gimpcoreconfig.[ch]
 * app/config/gimprc-blurbs.h: added new gimprc option
 "thumbnail-filesize-limit" that allows to control the maximum
 filesize for automatic thumbnail creation.

 * app/dialogs/preferences-dialog.c: added a GUI for it, needs
 review.

 * app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
 gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
  gimp_imagefile_save_thumbnail() to avoid it being called twice.

 * app/file/file-utils.[ch]: export utility function
 file_utils_find_proc_by_extension() that allows to check for a
 file plug-in by looking at the filename extension only.

 * app/widgets/gimpthumbbox.[ch]: automatically create or update
 thumbnails for image files with a known extension that are smaller
 than "thumbnail-filesize-limit".  Fixes bug #137176.

2004-10-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/ripple.c: handle the tile parameter identically
 for preview and final result. Set Edges options insensitive when
 "Retain tileability" is checked. Reported by Olivier.

2004-10-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/apply_lens.c (lens_dialog): invalidate the
 preview when the toggle buttons are used. Reported by Olivier.

 * app/widgets/gimpview.c: minor cleanup.

2004-10-08  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
 cancel the tool on GDK_Escape. Come cleanup.

2004-10-08  Michael Natterer  <mitch@gimp.org>

 Made the text options about two toolbox grid columns smaller.
 Addresses bug #122862.

 * app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
 the number of digits of the property's max_val plus two as number
 of chars for the sizeentry'y spinbutton (instead of always 10 as
 before).

 * app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
 has a minimal width of 150 pixels (eek). Set a silly small minimal
 width instead (the entry expands to the available width anyway).

2004-10-08  Sven Neumann  <sven@gimp.org>

 * app/file/file-utils.c: added lots of const qualifiers.

2004-10-08  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimppaintoptions-gui.c: the gradient button in blend
 options got lost, added it back. Also moved creation of the brush,
 pattern and gradient buttons to utility functions and cleaned up
 the whole file a bit.

2004-10-08  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
 (gimp_display_shell_flush)
 * app/gui/gui-vtable.c (gui_display_create): always pass a
 GimpDisplay, not a GimpDisplayShell as "data" to
 gimp_ui_manager_update().

 * app/actions/actions.c (action_data_get_*): removed checks if the
 passed data is a GimpDisplayShell and temporarily added g_assert()
 to be sure. The assertions will be removed before 2.2.

2004-10-07  Sven Neumann  <sven@gimp.org>

 * libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.

 * app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
 the size of the frame borders.

 * app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
 exactly the size of the frame borders. Otherwise we get large
 thumbnails (scaled down) if we request normal sized ones.

2004-10-07  Kevin Cozens  <kcozens@cvs.gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated
 constant ADD to CHANNEL-OP-ADD.

2004-10-07  Michael Natterer  <mitch@gimp.org>

 Merged the gz and bz2 plug-ins into one generic compression
 handler that can be extended by adding entries to a table of
 compressor definitions:

 * configure.in: removed bz2 special casing for win32.

 * plug-ins/common/bz2.c
 * plug-ins/common/gz.c: removed.

 * plug-ins/common/compressor.c: new plug-in.

 * plug-ins/common/plugin-defs.pl: changed accordingly.

 * plug-ins/common/.cvsignore
 * plug-ins/common/Makefile.am: regenerated.

2004-10-07  Simon Budig  <simon@gimp.org>

 * app/actions/view-commands.c: fill in the formula...  :-)
 untabbified.

 * app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified.

2004-10-07  Michael Natterer  <mitch@gimp.org>

 * app/actions/view-actions.c: changed zoom actions to be
 GimpEnumActions using the GimpActionSelectType enum. Enables
 keyboard shortcuts for useless stuff like "zoom out a lot", and
 makes them better accessible for external controllers.

 * app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback()
 to view_zoom_explicit_cmd_callback(), removed the zoom_in and
 zoom_out callbacks and added a new view_zoom_cmd_callback() for
 the new GimpActionSelectType-based actions. The implementation of
 the new zoom types is questionable but now there is a place where
 nomis can fill in nice formulas...

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpeditselectiontool.[ch]: added new parameter
 "gboolean propagate_release" to gimp_edit_slection_tool_start()
 and remember it in the GimpEditSelectionTool struct. If requested,
 propagate GimpTool::button_release() to the tool below in the tool
 stack.

 * app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
 pass FALSE so we don't get the button_release().

 * app/tools/gimpmovetool.[ch]: pass TRUE so we get
 button_release(). If moving a layer or path in "pick active" mode,
 remember the old active layer/path and switch back to it in
 button_release(). Fixes bug #97734.

 Unrelated:

 * app/tools/gimpeditselectiontool.c
 (gimp_edit_selection_tool_motion): set "first_move" to FALSE only
 if a move actually happened. Fixes un-undoable moves at high zoom
 factors.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
 which GdkDragContext the icon_widget was made.

 (gimp_dnd_data_drag_end): destroy the icon_widget only if it was
 created for this GdkDragContext. Fixes broken DND icon_widgets
 when dragging the same source again while the old icon_widget is
 still floating back from an unsuccessful drop. Fixes bug #139337.

2004-10-05  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/lib.pl: Slight cleanup of doc generating code.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc
 comment that contains a link to the replacement procedure and
 doesn't contain redundant information.

 * tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement
 procedures.

 * libgimp/gimpbrushes.c
 * libgimp/gimpgradients.c
 * libgimp/gimppalettes.c
 * libgimp/gimppatterns.c: made the handwritten gtk-doc comments of
 deprecated procedures look like the generated ones.

 * app/pdb/text_tool_cmds.c
 * libgimp/gimpbrushes_pdb.c
 * libgimp/gimpgradients_pdb.c
 * libgimp/gimppalettes_pdb.c
 * libgimp/gimppatterns_pdb.c
 * libgimp/gimptexttool_pdb.c: regenerated.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
 options before deserializing so they have the correct default
 values. Fixes bug #120832.

 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimpmagnifyoptions.c
 * app/tools/gimpselectionoptions.c
 * app/tools/gimptransformoptions.c: removed all set_defaults()
 utility functions and moved their code to reset(). The change
 above calls them automatically so there is no need to call them
 from the GUI constructors any more.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: use a
 scale_entry instead of a spinbutton, changed mnemonic from "R" to
 "E", indentation.

 * plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/
 in a comment.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/selection-round.scm: applied patch by
 Alan Horkan that improves usability and usefulness of this script.
 Did some code cleanup and added the old procedure for backward
 compatibility. Fixes bug #145147.

 * menus/image-menu.xml.in: renamed placeholder in Image->Select
 from "Outline" to "Modify".

2004-10-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c (ps_open): tweaked error message.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * app/pdb/procedural_db.h (struct ProcRecord): changed new member
 "deprecated" from "gboolean" to a "gchar*" which holds the name of
 the replacement procedure.

 * tools/pdbgen/app.pl: changed accordingly.

 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show
 the name of the replacement procedure in the warning message.

 * tools/pdbgen/stddefs.pdb: added utility function
 std_pdb_deprecated() which takes the name of the replacement
 procedure and fills the blurb, help, author, copyright, date and
 deprecated fields of the procedure definition.

 * tools/pdbgen/pdb/brushes.pdb
 * tools/pdbgen/pdb/gradients.pdb
 * tools/pdbgen/pdb/image.pdb
 * tools/pdbgen/pdb/palettes.pdb
 * tools/pdbgen/pdb/patterns.pdb
 * tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating
 the same code and strings for all deprecated procedures.

 * app/pdb/*_cmds.c
 * libgimp/gimppatterns_pdb.c
 * libgimp/gimptexttool_pdb.c: regenerated.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 Fixed the scale constraints radio buttons:

 * app/tools/gimptransformoptions.c (gimp_transform_options_gui):
 initialize the radio group with the correct value instead of
 resetting the model before creating the group.

 (gimp_scale_options_constrain_callback): change the model
 only if the radio button became active.

 (gimp_scale_options_constrain_notify): new callback which makes
 the radio buttons a real view on the model again (fixes GUI
 updates on modifier press/release).

2004-10-06  Sven Neumann  <sven@gimp.org>

 * app/actions/plug-in-actions.c (plug_in_actions_update): an image
 doesn't necessarily have a drawable. Handle the case when it doesn't.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * app/app_procs.[ch]
 * app/batch.[ch]
 * app/main.c: added new command-line option "--batch-interpreter"
 that allows to specify the procedure to use to process batch
 commands. Removed the perl-server hack but kept Script-Fu as the
 default for backward compatibility.

 * docs/gimp.1.in: documented the new option.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-commands.c (file_revert_confirm_callback):
 removed the code which sets the new image on all contexts where
 the old image was set...

 * app/display/gimpdisplay-foreach.c (gimp_displays_reconnect):
 ...and added it here so it happens for all calls of this function,
 also from the PDB. Fixes bug #154638.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * libgimp/gimp.def: updated.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the
 brush's pixmap data if it has one.

 * tools/pdbgen/pdb/pattern.pdb: cleaned up.

 * tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated
 functions even if they are not exported to libgimp any more.

 * app/pdb/procedural_db.h (struct ProcRecord): added member
 "gboolean deprecated".

 * tools/pdbgen/app.pl
 * app/xcf/xcf.c: fill it accordingly.

 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn
 not only for deprecated procedured which are in the compat hach
 table, but also for procedures with deprecated flag set to TRUE.

 * app/pdb/*_cmds.c
 * libgimp/gimpbrush_pdb.[ch]
 * libgimp/gimppattern_pdb.[ch]: regenerated.

 * libgimp/gimpbrushmenu.c
 * plug-ins/gfig/gfig-style.c: changed accordingly.

2004-10-05  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/lib.pl: Fix array return value generation when there
 are more args after it.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version number to 2.1.7.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/lib.pl: put subsequent deprecated prototypes into
 a single #ifndef ... #endif pair.

 * libgimp/gimpbrushes_pdb.h
 * libgimp/gimpgradients_pdb.h
 * libgimp/gimppalettes_pdb.h
 * libgimp/gimppatterns_pdb.h
 * libgimp/gimptexttool_pdb.h: regenerated.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimage.[ch]: store the time when the image is first
 dirtied.

 * app/display/gimpdisplayshell-close.c: tell the user what time
 period of changes will be lost when the image is not saved.

2004-10-06  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data)
 * tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform)
 (gradients_sample_custom) (gradients_get_gradient_data)
 * tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data):
 deprecated.

 * tools/pdbgen/pdb/brush.pdb
 * tools/pdbgen/pdb/gradient.pdb
 * tools/pdbgen/pdb/palette.pdb
 * tools/pdbgen/pdb/pattern.pdb: added replacements for the
 deprecated functions. Removed the silly feature that passing NULL
 as name operates on the current brush, pattern etc.

 * app/pdb/brush_cmds.c
 * app/pdb/brushes_cmds.c
 * app/pdb/gradient_cmds.c
 * app/pdb/gradients_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/palette_cmds.c
 * app/pdb/pattern_cmds.c
 * app/pdb/patterns_cmds.c
 * libgimp/gimpbrush_pdb.[ch]
 * libgimp/gimpbrushes_pdb.[ch]
 * libgimp/gimpgradient_pdb.[ch]
 * libgimp/gimpgradients_pdb.[ch]
 * libgimp/gimppalette_pdb.c
 * libgimp/gimppattern_pdb.[ch]
 * libgimp/gimppatterns_pdb.[ch]: regenerated.

 * libgimp/gimpbrushmenu.c
 * libgimp/gimpgradientmenu.c
 * libgimp/gimppatternmenu.c
 * plug-ins/FractalExplorer/Dialogs.c
 * plug-ins/common/gradmap.c
 * plug-ins/common/sample_colorize.c
 * plug-ins/flame/flame.c
 * plug-ins/gfig/gfig-style.c
 * plug-ins/gflare/gflare.c
 * plug-ins/pagecurl/pagecurl.c
 * plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly.

2004-10-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/spheredesigner.c: improved the dialog a bit,
 needs more work.

2004-10-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/addborder.scm: simple change to make
 the script work on all image types, not only RGB.

2004-10-05  Sven Neumann  <sven@gimp.org>

 * Made 2.1.6 release.

2004-10-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c: added a close button. Launch the
 browser with the HTML focused.

2004-10-05  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
 left-justify the label.

 * libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP
 is being added, hide the automatically added help button.

 * plug-ins/script-fu/script-fu-interface.c: five buttons are too
 much for the action area. Renamed the About button to Help and
 resurrected the help button in the about dialog as a way to get to
 the actual help pages (pressing F1 will get you there as well).

2004-10-05  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c: added a help button.

2004-10-05  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
 - check the number of elements of array parameters against
   the actually passed array and spit a proper error message
   instead of trashing the wire. Fixes bug #154266.
 - g_strdup()/g_free() the proc_name so it doesn't get mungled
   by convert_string().
 - added missing implementation of INT16ARRAY return values.
 - cleaned up STRINGARRAY value implementations to work like
   all other array values.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_reset):
 fixed reset for SF_TEXT values.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
 oops, didn't meant to remove that line.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area):
 take drawable offsets into account when masking the preview with
 the selection mask.

2004-10-04  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow
 the empty string as token. Spotted by Kevin Cozens.

 * app/pdb/gimprc_cmds.c: regenerated.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer):
 no need to set bpp before calling gimp_drawable_get_thumbnail_data().

2004-10-04  DindinX  <dindinx@gimp.org>

 * libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer):
 only apply the effect inside the current selection. This, together
 with my previous commit fixes bug #132194.

2004-10-04  DindinX  <dindinx@gimp.org>

 * plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This
 addresses but not totally fixes bug #132194.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * app/config/gimpguiconfig.[ch]
 * app/config/gimprc-blurbs.h: added gimprc option "show-help-button".

 * app/dialogs/preferences-dialog.c: added a GUI for it.

 * app/dialogs/file-save-dialog.c
 * app/dialogs/image-new-dialog.c
 * app/dialogs/quit-dialog.c
 * app/display/gimpdisplayshell-close.c
 * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
 dialogs.

 * libgimpbase/gimpprotocol.[ch]
 * libgimp/gimp.[ch]: added boolean "show_help_button" to the
 config message.

 * app/plug-in/plug-in-run.c: pass the new preference to the plug-in.

 * libgimpwidgets/gimpdialog.[ch]: added new function that allows to
 set whether new dialogs should get a help button added.

 * app/gui/gui.c
 * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
 to the gimprc settings.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_about): set 
 the help_func again (but not the help_id).

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_about):
 enabled line wrapping on labels.
 (script_fu_interface): substitute underscores by hyphens to
 generate the help-id from the procedure name.

2004-10-04  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimpwire.c: added assertions to make sure "count" is
 always >= 0. Turns the crash described in bug #154266 into a
 warning plus corrupted wire state :) Real fix (in script-fu) will
 follow. Untabified.

2004-10-04  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimphelpui.c: untabified.

 (gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id".

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
 set a minimum width for the color button again.
 (script_fu_about): don't set help_func and help_id on the about
 dialog.

2004-10-04  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/brush.pdb
 * tools/pdbgen/pdb/gradient.pdb
 * tools/pdbgen/pdb/palette.pdb: disallow the empty string for
 new brushes, gradients and palettes and check the return value
 of gimp_data_factory_data_new(). Cleanup.

 * app/core/gimpbrushgenerated.c (gimp_brush_generated_new)
 * app/core/gimpgradient.c (gimp_gradient_new)
 * app/core/gimpdatafactory.c (gimp_data_factory_data_new): same
 here. Fixes bug #154264.

 * app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean
 "deletable" parameter because it's not derivable from "writable".

 * app/core/gimpdatafactory.c (gimp_data_factory_load_data): need
 to figure "deletable" separately from "writable" to be able to
 delete unsavable stuff in the user-writable data directories.
 Fixes bug #154410.

 (gimp_data_factory_data_save_single): cleaned up.

 * app/pdb/brush_cmds.c
 * app/pdb/gradient_cmds.c
 * app/pdb/palette_cmds.c
 * libgimp/gimpbrush_pdb.c
 * libgimp/gimpgradient_pdb.c
 * libgimp/gimppalette_pdb.c: regenerated.

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of
 the script contributed by Kevin Cozens (see bug #153900).
 
 * plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin
 Cozens that fixes use of the script on original layer (bug #152678).

2004-10-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/3d-outline.scm
 * plug-ins/script-fu/scripts/blended-logo.scm
 * plug-ins/script-fu/scripts/camo.scm
 * plug-ins/script-fu/scripts/clothify.scm
 * plug-ins/script-fu/scripts/flatland.scm
 * plug-ins/script-fu/scripts/glossy.scm
 * plug-ins/script-fu/scripts/land.scm
 * plug-ins/script-fu/scripts/predator.scm
 * plug-ins/script-fu/scripts/rendermap.scm
 * plug-ins/script-fu/scripts/ripply-anim.scm
 * plug-ins/script-fu/scripts/speed-text.scm
 * plug-ins/script-fu/scripts/spinning-globe.scm: applied patches
 from Kevin Cozens that define variables before first use (bug
 #153900).

2004-10-04  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpgradientmenu.c: handle allocation > requisition for
 the gradient preview.

 * plug-ins/script-fu/script-fu-interface.c: added a horizontal
 size group for the left-aligned controls.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/destripe.c: ported to GimpDrawablePreview.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/nova.c: ported to GimpAspectPreview.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/max_rgb.c: ported to GimpAspectPreview.

2004-10-03  Michael Schumacher <schumaml@gmx.de>

 * plug-ins/dbbrowser/Makefile.am
 * plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to
 the beginning of LDADD
 
2004-10-03  DindinX  <dindinx@gimp.org>

 * libgimp/gimpaspectpreview.c: limit the size of the preview to 512
 pixels.  This prevents plug-ins using gimp_drawable_get_thumbnail_data
 to crash.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/emboss.c: ported to GimpAspectPreview and made some
 cleanups so this plug-in now use the same naming scheme as other
 plug-ins do.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/whirlpinch.c: ported to GimpAspectPreview.

2004-10-03  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB.
 Fixes bug #154368.

 * app/pdb/color_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpcolor_pdb.[ch]: regenerated.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/blinds.c: use a GimpAspectPreview to make the
 preview resizable.

2004-10-03  DindinX  <dindinx@gimp.org>

 * plug-ins/common/ripple.c: Added a preview.

2004-10-02  DindinX  <dindinx@gimp.org>

 * plug-ins/common/polar.c: use a GimpAspectPreview.

2004-10-02  DindinX  <dindinx@gimp.org>

 * plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the
 code much simpler.

2004-10-02  DindinX  <dindinx@gimp.org>

 * plug-ins/common/illusion.c: use a GimpAspectPreview so the preview
 is now resizable.

2004-10-02  DindinX  <dindinx@gimp.org>

 * plug-ins/common/apply_lens.c: added a preview.  This plug-in still
 need some work.

2004-10-01  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_tool_events): dispatch GDK_Escape to
 GimpTool::key_press().

 * app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
 * app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
 cancel the tool on <Escape>.

2004-10-01  Sven Neumann  <sven@gimp.org>

 * plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin.

2004-10-01  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpcroptool.c (crop_response): destroy the info
 dialog instead of hiding it. Fixes session management.

2004-10-01  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpcroptool.c: unset the highlight from
 crop_response() so it gets called when cropping is cancelled.

 * app/dialogs/info-dialog.c (info_dialog_show): do what the
 function name says, show the window, but don't present it.
 Fixes bugs #128833 and #138816.

2004-10-01  Sven Neumann  <sven@gimp.org>

 * themes/Default/images/stock-frame-64.png: replaced the obtrusive
 drop-shadow by a thin white frame with a subtle shadow. Taken from
 a mockup done by Jimmac.

 * app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
 offsets for the new frame image :(

2004-10-01  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-callbacks.c: no need to include
 gimpdisplayshell-render.h here.

 * app/display/gimpdisplayshell-draw.c
 * app/display/gimpdisplayshell-render.[ch]

 * app/display/gimpdisplayshell.[ch]: added an API to highlight a
 rectangle (specified in image coordinates). Actually it doesn't
 highlight but dims the area outside the rectangle.

 * app/tools/gimpcroptool.c: use the new functionality to show the
 area to be cropped. Fixes bug #93360.

2004-09-30  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed
 member "decription" to "menu_path".

 * plug-ins/script-fu/script-fu-interface.c: changed accordingly.

 * plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the
 menu_path as "blurb" to gimp_install_temp_proc(). Instead,
 pass "help" as "blurb" and nothing as "help".

 * plug-ins/script-fu/scripts/test-sphere.scm: shortened overly
 long and useless help text.

2004-09-30  Michael Natterer  <mitch@gimp.org>

 * plug-ins/dbbrowser/gimpprocbox.c: don't include
 "libgimp/stdplugins-intl.h".

 * plug-ins/dbbrowser/gimpprocbrowser.c
 * plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs()
 so we don't leak all param names and descriptions.

 * plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or
 redundant information (help == blurb for deprecated procedures).

2004-09-30  Michael Natterer  <mitch@gimp.org>

 * plug-ins/dbbrowser/Makefile.am
 * plug-ins/dbbrowser/gimpprocbox.c: new files holding more common
 code from the two browsers.

 * plug-ins/dbbrowser/gimpprocbrowser.c: use it.

 * plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting
 by all columns in both views. More cleanup.

2004-09-30  Sven Neumann  <sven@gimp.org>

 * README: added missing linebreak.

 * plug-ins/imagemap/imap_about.c (do_about_dialog): should not
 mark email address for translation.

2004-09-30  Daniel Egger  <degger@fhm.edu>

 * README: Applied proofreading patch from Jonathan Levi
 <drjlevi@netonecom.net>.

2004-09-30  Michael Natterer  <mitch@gimp.org>

 Cleaned up the DB Browser and Plugin Details code and GUI.  It's
 not perfect yet but at least they don't look like crap any more.
 Fixes bug #131490.

 * plug-ins/common/plugin-defs.pl
 * plug-ins/common/plugindetails.c: removed this plugin.

 * plug-ins/common/.cvsignore
 * plug-ins/common/Makefile.am: regenerated.

 * plug-ins/dbbrowser/Makefile.am
 * plug-ins/dbbrowser/dbbrowser.c
 * plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files.

 * plug-ins/dbbrowser/gimpprocbrowser.[ch]
 * plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files.

 * plug-ins/dbbrowser/plugin-browser.c: the former plugindetails.
 * plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser.

 * plug-ins/script-fu/Makefile.am: link against the new library
 libgimpprocbrowser.a

 * plug-ins/script-fu/script-fu-console.c: changed #includes
 accordingly. Minor cleanup.

 * tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path
 return value. Was broken since the plug-in menu registering
 changes.

 * app/pdb/plug_in_cmds.c: regenerated.

2004-09-30  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
 I introduced with my last cleanup.

2004-09-29  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch
 from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and
 untabbifies things. Closes bug #153921.

 * plug-ins/pygimp/plug-ins/gimpplugin.py
 * plug-ins/pygimp/plug-ins/gimpshelf.py
 * plug-ins/pygimp/plug-ins/gimpui.py: Untabbify.

2004-09-29  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history
 behavior.

 * plug-ins/pygimp/plug-ins/clothify.py
 * plug-ins/pygimp/plug-ins/foggify.py
 * plug-ins/pygimp/plug-ins/gimpcons.py
 * plug-ins/pygimp/plug-ins/gtkcons.py
 * plug-ins/pygimp/plug-ins/pdbbrowse.py
 * plug-ins/pygimp/plug-ins/shadow_bevel.py
 * plug-ins/pygimp/plug-ins/sphere.py
 * plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify.

2004-09-29  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
 tiny memleak spotted by Olivier.

2004-09-29  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]
 * libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer().

 * libgimp/gimpaspectpreview.[ch]
 * libgimp/gimpdrawablepreview.[ch]
 * libgimp/gimpui.def: removed the public draw_buffer API.
 Implement the virtual GimpPreview::draw_buffer method instead.

 * plug-ins/common/cartoon.c
 * plug-ins/common/deinterlace.c
 * plug-ins/common/despeckle.c
 * plug-ins/common/dog.c
 * plug-ins/common/edge.c
 * plug-ins/common/engrave.c
 * plug-ins/common/exchange.c
 * plug-ins/common/gauss.c
 * plug-ins/common/grid.c
 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/oilify.c
 * plug-ins/common/photocopy.c
 * plug-ins/common/plasma.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/sharpen.c
 * plug-ins/common/shift.c
 * plug-ins/common/snoise.c
 * plug-ins/common/sobel.c
 * plug-ins/common/spread.c
 * plug-ins/common/struc.c: changed accordingly. Don't pass the
 preview around as GimpDrawablePreview or GimpAspectPreview. It
 should whenever possible be accessed as GimpPreview.

2004-09-29  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]
 * libgimpwidgets/gimpscrolledpreview.[ch]
 * libgimpwidgets/gimpwidgets.def: moved the offsets and the
 draw_thumb method back to the GimpPreview class.

 * libgimp/gimpdrawablepreview.c: changed accordingly.

 * plug-ins/common/bumpmap.c
 * plug-ins/common/cartoon.c
 * plug-ins/common/deinterlace.c
 * plug-ins/common/despeckle.c
 * plug-ins/common/dog.c
 * plug-ins/common/edge.c
 * plug-ins/common/engrave.c
 * plug-ins/common/exchange.c
 * plug-ins/common/gauss.c
 * plug-ins/common/grid.c
 * plug-ins/common/mblur.c
 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/oilify.c
 * plug-ins/common/photocopy.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/sharpen.c
 * plug-ins/common/shift.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/struc.c
 * plug-ins/common/unsharp.c
 * plug-ins/common/wind.c: back to using gimp_preview_get_position().

 * libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected
 gtk-doc comment.

2004-09-29  DindinX  <dindinx@gimp.org>

 * plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the
 preview is resizable.

2004-09-29  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpui.def
 * libgimpwidgets/gimpwidgets.def: updated.

2004-09-29  DindinX  <dindinx@gimp.org>

 * libgimpwidgets/gimppreview.c
 * libgimpwidgets/gimppreview.h: split this widget into itself (more
 abstract now) and ...

 * libgimpwidgets/gimpscrolledpreview.c
 * libgimpwidgets/gimpscrolledpreview.h: this widget which also have
 some scrollbars and a nagivation preview.

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgetstypes.h: changed accordingly.

 * libgimp/gimpaspectpreview.c
 * libgimp/gimpaspectpreview.h: Added this widget, derived from
 GimpPreview, which has always the same ratio has the given drawable.
 This widget has almost the same api as GimpDrawablePreview, and is
 useful for plug-ins that show the whole (scaled) drawable in their
 preview.

 * libgimp/gimpdrawablepreview.c
 * libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived
 from GimpScrolledPreview.

 * libgimp/Makefile.am
 * libgimp/gimpui.h
 * libgimp/gimpuitypes.h: changed accordingly.

 * plug-ins/common/plasma.c: use a GimpAspectPreview.

 * plug-ins/common/bumpmap.c
 * plug-ins/common/cartoon.c
 * plug-ins/common/deinterlace.c
 * plug-ins/common/despeckle.c
 * plug-ins/common/dog.c
 * plug-ins/common/edge.c
 * plug-ins/common/engrave.c
 * plug-ins/common/exchange.c
 * plug-ins/common/gauss.c
 * plug-ins/common/grid.c
 * plug-ins/common/mblur.c
 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/oilify.c
 * plug-ins/common/photocopy.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/sharpen.c
 * plug-ins/common/shift.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/struc.c
 * plug-ins/common/unsharp.c
 * plug-ins/common/wind.c: use gimp_scrolled_preview_get_position
 instead of gimp_preview_get_position.

2004-09-29  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpregioniterator.[ch]: renamed the "run_mode"
 parameters to "unused" and remode the rum_mode member from the
 private GimpRgbIterator struct.

 * plug-ins/common/AlienMap2.c
 * plug-ins/common/autostretch_hsv.c
 * plug-ins/common/c_astretch.c
 * plug-ins/common/color_enhance.c
 * plug-ins/common/colorify.c
 * plug-ins/common/colortoalpha.c
 * plug-ins/common/gradmap.c
 * plug-ins/common/mapcolor.c
 * plug-ins/common/max_rgb.c
 * plug-ins/common/noisify.c
 * plug-ins/common/normalize.c
 * plug-ins/common/sample_colorize.c
 * plug-ins/common/scatter_hsv.c
 * plug-ins/common/semiflatten.c
 * plug-ins/common/threshold_alpha.c
 * plug-ins/common/vinvert.c
 * plug-ins/fp/fp.c: made "run_mode" a private variable of run()
 and pass 0 to gimp_rgn_iterate*(). Minor cleanups.

2004-09-29  Sven Neumann  <sven@gimp.org>

 * libgimp/gimp.def
 * libgimp/gimpui.def
 * libgimpwidgets/gimpwidgets.def: updated.

2004-09-29  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/groups.pl: renamed group "gradient_edit" to
 "gradient" and added "brush", "palette" and "pattern" groups.

 * tools/pdbgen/pdb/gradient_edit.pdb: removed.

 * tools/pdbgen/pdb/brush.pdb
 * tools/pdbgen/pdb/gradient.pdb
 * tools/pdbgen/pdb/palette.pdb
 * tools/pdbgen/pdb/pattern.pdb: new files containing functions
 which create, duplicate, rename, delete, query and manipulate
 a single brush, pattern etc.

 * tools/pdbgen/pdb/brushes.pdb
 * tools/pdbgen/pdb/gradients.pdb
 * tools/pdbgen/pdb/palettes.pdb
 * tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete
 now and simply removed the procedures that were added after 2.0.

 * app/pdb/gradient_edit_cmds.c
 * libgimp/gimpgradientedit_pdb.[ch]: removed.

 * app/pdb/brush_cmds.c
 * app/pdb/gradient_cmds.c
 * app/pdb/palette_cmds.c
 * app/pdb/pattern_cmds.c
 * libgimp/gimpbrush_pdb.[ch]
 * libgimp/gimpgradient_pdb.[ch]
 * libgimp/gimppalette_pdb.[ch]
 * libgimp/gimppattern_pdb.[ch]: new files.

 * app/pdb/brushes_cmds.c
 * app/pdb/gradients_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/palettes_cmds.c
 * app/pdb/patterns_cmds.c
 * libgimp/gimp_pdb.h
 * libgimp/gimpbrushes_pdb.[ch]
 * libgimp/gimpgradients_pdb.[ch]
 * libgimp/gimppalettes_pdb.[ch]
 * libgimp/gimppatterns_pdb.[ch]: regenerated.

 * app/pdb/Makefile.am
 * libgimp/Makefile.am
 * plug-ins/gfig/gfig-style.c: changed accordingly.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/file/gimprecentlist.c (gimp_recent_list_write): don't write
 empty groups.

 * app/file/gimprecentlist.c: disabled the code for the win32
 platform. It doesn't make much sense there anyway. If someone
 wants to contribute a win32 specific implementation, we'd welcome
 that. A Mac OS X implementation would be nice to have as well.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce.

2004-09-28  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_circle.c: 
 * plug-ins/imagemap/imap_cmd_gimp_guides.c
 * plug-ins/imagemap/imap_edit_area_info.c
 * plug-ins/imagemap/imap_grid.c
 * plug-ins/imagemap/imap_polygon.c 
 * plug-ins/imagemap/imap_rectangle.c
 * plug-ins/imagemap/imap_settings.c: first set of changes to make
 imagemap fully HIG compliant. More to come.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/file/gimprecentlist.c: seek to the start of the file before
 calling lockf().

2004-09-28  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/common/borderaverage.c: added size entry. Fixes #143156
 (Use size entry widget in Borderaverage plug-in)

2004-09-28  Sven Neumann  <sven@gimp.org>

 * docs/gimp.1.in: updated name of the splash image.

2004-09-28  Michael Natterer  <mitch@gimp.org>

 * app/core/gimppalette.c: code review / cleanup.

 (gimp_palette_delete_entry): don't add "Black" when the last color
 gets removed, a palette can easily live with zero colors.

 * app/widgets/gimppaletteeditor.c
 (palette_editor_invalidate_preview): also update the entry which
 shows the palette_entry's name.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle
 EINTR while writing.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/config/gimpxmlparser.[ch]: added new convenience function
 gimp_xml_parser_parse_fd().

 * app/file/Makefile.am
 * app/file/gimprecentitem.[ch]
 * app/file/gimprecentlist.[ch]: added an implementation of the
 recent-files spec as found on freedesktop.org. This code is taken
 from libegg and has been edited to fit the GIMP needs.

 * app/file/file-open.c
 * app/file/file-save.c: update the ~/.recently-used file. Fixes
 bug #131206.

2004-09-28  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
 removed hack which strcmp()s the property name to figure the
 preview's border_width and use the container view's
 preview_border_width instead.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
 simplified code and removed a compiler warning.

2004-09-28  Carol Spears  <carol@gimp.org>

 * data/images/gimp-splash.png there was a white spot that was making
 me crazy.  It is gone now.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
 to get rid of the border drawn around thumbnails in the "Open Recent"
 menu.

2004-09-28  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
 add a shortcut to the filechooser that points to the user's folder.

 * app/actions/vectors-commands.c: added a file filter to the SVG
 import dialog.

2004-09-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
 padding for the shadow frame to avoid scaling the thumbnail.

2004-09-27  Sven Neumann  <sven@gimp.org>

 * themes/Default/images/Makefile.am
 * themes/Default/images/stock-frame-64.png: added a stock icon
 that shows a simple drop shadow but could be exchanged for other
 image decorations.

 * libgimpwidgets/gimpstock.[ch]: register the new icon.

 * app/widgets/Makefile.am
 * app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
 ugly code to draw a frame around a preview pixbuf.

 * app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
 to the GimpViewRenderer class so it can be shared by all renderers.

 * app/widgets/gimpviewrendererimagefile.c: use the new functionality
 to draw a nice frame around imagefile previews.

 * app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.

2004-09-27  Michael Natterer  <mitch@gimp.org>

 * app/actions/data-commands.c: cleanup.

 * app/actions/vectors-commands.c
 * app/display/gimpdisplayshell.c
 * tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.

 * app/text/gimptext-bitmap.c
 * app/text/gimptext-parasite.c
 * app/text/gimptext-vectors.c
 * app/text/gimptext-xlfd.c
 * app/text/gimptext.c
 * app/text/gimptextlayer-xcf.c: include "text-types.h" instead
 of "text/text-types.h".

 * app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
 instead of GimpDataFactoryView.

 * app/pdb/paint_tools_cmds.c: regenerated.

2004-09-27  Michael Natterer  <mitch@gimp.org>

 * app/actions/brushes-actions.c
 * app/actions/gradients-actions.c
 * app/actions/palettes-actions.c
 * app/actions/patterns-actions.c: made the "foo-edit" actions
 GimpStringActions and pass the identifier of the editor dialog
 to the callback.

 * app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
 show the editor dialog here instead of calling view->edit_func().

 * app/dialogs/dialogs-constructors.[ch]: removed the brush,
 gradient and palette edit_funcs.

 * app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

 * app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
 member and parameters and create the edit button unconditionally.

 * app/widgets/gimpbrushfactoryview.[ch]
 * app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

 * app/widgets/Makefile.am
 * app/widgets/gimpdataselect.[ch]: removed this class, it's not
 needed any longer.

 * app/widgets/gimpbrushselect.[ch]
 * app/widgets/gimpgradientselect.[ch]
 * app/widgets/gimppaletteselect.[ch]
 * app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
 and follow the edit_func removal.

 * app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
 stuff.

 * app/widgets/gimpcontainereditor.c: minor unrelated cleanup.

2004-09-27  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors
 for consistency and added a (useless) template grid.

 * app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries
 more readable by using macros to define them.

2004-09-27  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimagefile.c: removed conversion to TempBuf.
 Instead implement GimpViewable::get_new_pixbuf by compositing the
 thumbnail on a checkerboard.

 * app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
 struct member to pixbuf.
 (gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
 and render the pixbuf before falling back to the TempBuf preview.
 (gimp_view_renderer_render_pixbuf): new function that sets a
 pixbuf for the renderer and flushes the render_buffer.

 * app/widgets/gimpviewrendererimagefile.c
 (gimp_view_renderer_imagefile_render): render the pixbuf.

 * app/dialogs/dialogs-constructors.c: create the document history
 dockable with a zero borderwidth.

2004-09-27  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
 the GIMP_CHECK_SIZE_SM define, not the enum value
 GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).

 * app/pdb/fileops_cmds.c: regenerated.

 * app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.

2004-09-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdataeditor.[ch]: added "data" property.

 * app/widgets/gimpbrusheditor.c
 * app/widgets/gimpgradienteditor.c
 * app/widgets/gimppaletteeditor.c: pass the current data to
 g_object_new() so we never end up with initially empty editors.

2004-09-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
 "data-factory" property. Removed gimp_data_editor_construct().

 * app/widgets/gimpbrusheditor.c
 * app/widgets/gimpgradienteditor.c
 * app/widgets/gimppaletteeditor.c: pass the construct parameters
 to g_object_new().

2004-09-26  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcolorframe.c: changed label alignment to be more
 HIG conformant and consistent with the rest of the user interface.

2004-09-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
 "stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
 gimp_dialog_factory_dialog_register(). Added typedef
 GimpDialogConstructor which takes a GimpDialogFactoryEntry in
 addition to the parameters GimpDialogNewFunc takes. Added a
 constructor function pointer to GimpDialogFactory which defaults
 to a function that just returns entry->new_func(). Use that
 constructor instead of entry->new_func() for creating
 dialogs. Added public API gimp_dialog_factory_set_constructor().

 * app/dialogs/dialogs.c: register name, blurb, stock_id and
 help_id for all dockables so all the dialog info lives in one huge
 ugly table now. For the global_toolbox_factory and the
 global_dock_factory, set a constructor which creates a dockable
 around the widget returned by entry->new_func().

 * app/dialogs/dialogs-constructors.[ch]: don't create the dockable
 in each dialog constructor. Removes tons of code and reduces most
 constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
 all static variables, they were from a time when GimpDialogFactory
 was unable to manage singletons.

 * app/widgets/gimpbrusheditor.[ch]
 * app/widgets/gimpgradienteditor.[ch]
 * app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
 GimpDataEditor from gimp_foo_editor_new().

 * app/widgets/gimpdataeditor.c: minor cleanups.

2004-09-26  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcolordialog.c: moved stuff from new() to init().

2004-09-26  Michael Natterer  <mitch@gimp.org>

 Ported GimpNavigationView to use actions for its buttons:

 * app/menus/menus.c (menus_init): register a <GimpNavigationEditor>
 UI manager containing the "view" action group.

 * app/actions/actions.c (action_data_get_foo): handle "data" being
 a GimpNavigationEditor.

 * app/actions/view-actions.c (view_actions): added tooltips for
 the actions used in the editor.

 (view_actions_update): use action_data_get_display() instead of
 checking the type of "data" manually.

 * app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
 a GtkToggleButton instead of GimpButton for GtkToggleActions.

 * app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
 parameter to the public constructor and removed all other
 parameters. Simplified gimp_navigation_editor_new_private() and
 use gimp_editor_add_action_button() instead of just add_button()
 for creating the buttons. Made gimp_navigation_view_set_shell()
 private. Update the UI manager when the shell zooms or scrolls.

 * app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
 pass the menu_factory to gimp_navigation_editor_new().

 Removed #includes which are not needed any more.

2004-09-26  DindinX  <dindinx@gimp.org>

 * plug-ins/common/exchange.c: use the same preview as in all other
 plug-ins.

2004-09-25  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_stock.c: removed C++ style comment.

2004-09-25  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_stock.[ch]
 * plug-ins/imagemap/Makefile.am
 * plug-ins/imagemap/*.xpm: get rid of all .xpm images

 * configure.in 
 * plug-ins/imagemap/images/*: and add them as .png here

 * plug-ins/imagemap/imap_browse.c: remove unused include.
 
2004-09-25  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpviewrenderer.h: removed trailing whitespace.

2004-09-25  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-close.c: changed mnemonic so that
 you can close an image w/o saving it by using Ctrl-W Alt-W.

2004-09-25  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage-qmask.h: added comment about not changing the
 silly "Qmask" string because it is used to identify the Quick Mask
 in the XCF.

 * app/core/gimpchannel.c: implement GimpViewable::get_description()
 and return "Quick Mask" if it's the Quick Mask.

 * app/actions/qmask-actions.c
 * app/actions/qmask-commands.c
 * app/core/core-enums.[ch]
 * app/core/gimpimage-qmask.c
 * app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/.

2004-09-25  DindinX  <dindinx@gimp.org>

 * plug-ins/common/engrave.c: Added a preview and #if'ed out some
 unreachable code.

2004-09-25  Michael Natterer  <mitch@gimp.org>

 * app/core/gimppickable.[ch]: added new vitrual function
 GimpPickableInterface::get_image()

 * app/core/gimpdrawable.c
 * app/core/gimpimagemap.c
 * app/core/gimpprojection.[ch]: implement it.

2004-09-25  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcolormapeditor.[ch]
 * app/widgets/gimphistogrameditor.[ch]
 * app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
 parameters from public constructors. They are all GimpImageEditor
 widgets which get their image via gimp_docked_set_context() and
 gimp_image_editor_set_image() later anyway. Fixes uglyness as well
 as problems where the editors had an image but no context, causing
 strange behavior in their foo_actions_update() functions.

 * app/dialogs/dialogs-constructors.c: changed accordingly. Removed
 redundant calls to gimp_dockable_set_context() on newly created
 dockables because they will get a context when added to their
 containers.

2004-09-25  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcolormapeditor.c: moved stuff from
 gimp_colormap_editor_new() to
 gimp_colormap_editor_init(). Untabified.

2004-09-25  DindinX  <dindinx@gimp.org>

 * plug-ins/common/dog.c: made the preview behave like in all other
 plug-ins by using a GimpDrawablePreview.  This allowed to remove a
 bunch of complicated code.

2004-09-25  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.[ch]: added resolution and image
 type information which is usually hidden in the Advanced Options.

2004-09-25  DindinX  <dindinx@gimp.org>

 * plug-ins/common/oilify.c: Added a preview and made some small
 cleanups.

2004-09-24  Sven Neumann  <sven@gimp.org>

 * app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to
 improve the tooltip for the layer-preview-size gimprc setting.
 Addresses bug #153603.

2004-09-24  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored
 common code out of the UNDO amd REDO cases. Use gimp_drawable_update()
 instead of gimp_viewable_invalidate_preview() so the projection
 gets updated correctly. Fixes bug #149558.

 * app/core/gimplayer-floating-sel.c (floating_sel_to_layer):
 removed unused variables and their assignments.

2004-09-24  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.[ch]: added a label that shows
 the pixel size (as in the initial mockup done by Jimmac).

2004-09-24  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpimagemaptool.c
 (gimp_image_map_tool_settings_dialog): set the folder using
 gtk_file_chooser_set_current_folder(), not set_filename().

2004-09-24  Sven Neumann  <sven@gimp.org>

 * app/base/curves.[ch]
 * app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.

 * tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
 last control point which got initialized to (255,255) by
 curves_init(). Fixes bug #153635.

 * app/pdb/color_cmds.c: regenerated.

2004-09-24  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-in-message.c: removed a linebreak from a
 warning message.

2004-09-24  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimpairbrushoptions.c
 * app/paint/gimpcloneoptions.c
 * app/paint/gimpconvolveoptions.c
 * app/paint/gimpdodgeburnoptions.c
 * app/paint/gimperaseroptions.c
 * app/paint/gimpinkoptions.c
 * app/paint/gimppaintoptions.c
 * app/paint/gimppenciloptions.c
 * app/paint/gimpsmudgeoptions.c
 * app/tools/gimpblendoptions.c
 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimpcoloroptions.c
 * app/tools/gimpcolorpickeroptions.c
 * app/tools/gimpcropoptions.c
 * app/tools/gimpflipoptions.c
 * app/tools/gimphistogramoptions.c
 * app/tools/gimpimagemapoptions.c
 * app/tools/gimpmagnifyoptions.c
 * app/tools/gimpmeasureoptions.c
 * app/tools/gimpmoveoptions.c
 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimpselectionoptions.c
 * app/tools/gimptextoptions.c
 * app/tools/gimptransformoptions.c
 * app/tools/gimpvectoroptions.c: code cleanup: untabified and
 trailing whitespace removal, removed empty instance_init()
 funcions, cleaned up variable declarations/initializations.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
 * app/tools/gimppenciltool.c (gimp_pencil_tool_register):
 add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
 these tools use the current gradient. Fixes bug #153584.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/Makefile.am
 * app/dialogs/color-dialog.[ch]: removed...

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcolordialog.[ch]: ...and added as widget.

 * app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

 * app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

 * app/widgets/gimpcolormapeditor.[ch]
 * app/widgets/gimpcolorpanel.[ch]
 * app/widgets/gimpgradienteditor.[ch]
 * app/widgets/gimppaletteeditor.[ch]
 * app/widgets/gimptoolbox-color-area.c
 * app/actions/gradient-editor-commands.c
 * app/actions/view-commands.c: ported to GimpColorDialog. Removes
 a whole bunch of ugly widgets/ -> dialogs/ dependencies.

2004-09-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c: put the text view into
 a scrolled window. Removed "changed" callbacks for GtkEntry and
 GtkTextView. Instead retrieve the final string when the dialog is
 confirmed.

 * plug-ins/script-fu/scripts/carved-logo.scm
 * plug-ins/script-fu/scripts/chrome-it.scm
 * plug-ins/script-fu/scripts/crystal-logo.scm
 * plug-ins/script-fu/scripts/sota-chrome-logo.scm: use
 gimp-data-directory instead of the deprecated constant
 gimp-data-dir.

 * plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for
 translation that I marked yesterday. Won't work unfortunately.

2004-09-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/blended-logo.scm: fixed context
 push/pop.

2004-09-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-enums.h
 * plug-ins/script-fu/script-fu-interface.c
 * plug-ins/script-fu/script-fu-scripts.c
 * plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin
 Cozens, based on a patch by Dov Grobgeld. Implements multi-line
 text input in Script-Fu (bug #124394).

 * plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT
 parameter.

2004-09-23  Sven Neumann  <sven@gimp.org>

 * libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail,
 gimp_image_get_thumbnail): use the exported symbols from
 libgimp, not the private _gimp_drawable_thumbnail()
 and _gimp_image_thumbnail() functions.

 * libgimp/gimp.def: added new symbols, removed
 _gimp_image_thumbnail and _gimp_drawable_thumbnail.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/brushes.pdb
 * tools/pdbgen/pdb/gradients.pdb
 * tools/pdbgen/pdb/palettes.pdb
 * tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo()
 procedures and marked the foos_get_foo() ones as deprecated. For
 brushes, patterns and palettes, added foos_get_foo_info()
 procedures which work like foos_get_foo_data() but return just the
 properties, not the actual data. Allow NULL or "" to be passed
 as name to all functions (use the current brush, pattern etc.
 in this case).

 * tools/pdbgen/pdb/fonts.pdb: cleanup.

 * app/pdb/procedural_db.c: added the removed ones to the compat
 hash table.

 * libgimp/Makefile.am
 * libgimp/gimpbrushes.[ch]
 * libgimp/gimpgradients.[ch]
 * libgimp/gimppalettes.[ch]
 * libgimp/gimppatterns.[ch]: new files with compat functions
 wich call the resp. gimp_context_*() functions.

 * libgimp/gimp.h: changed accordingly.

 * app/pdb/brushes_cmds.c
 * app/pdb/gradients_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/palettes_cmds.c
 * app/pdb/patterns_cmds.c
 * libgimp/gimpbrushes_pdb.[ch]
 * libgimp/gimpgradients_pdb.[ch]
 * libgimp/gimppalettes_pdb.[ch]
 * libgimp/gimppatterns_pdb.[ch]: regenerated.

 * plug-ins/FractalExplorer/Dialogs.c
 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-style.[ch]
 * plug-ins/gflare/gflare.c: changed accordingly.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for
 packing preview and controls so the controls are resizable again.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/3d-outline.scm
 * plug-ins/script-fu/scripts/beveled-pattern-arrow.scm
 * plug-ins/script-fu/scripts/beveled-pattern-bullet.scm
 * plug-ins/script-fu/scripts/beveled-pattern-button.scm
 * plug-ins/script-fu/scripts/beveled-pattern-heading.scm
 * plug-ins/script-fu/scripts/beveled-pattern-hrule.scm
 * plug-ins/script-fu/scripts/blended-logo.scm
 * plug-ins/script-fu/scripts/carve-it.scm
 * plug-ins/script-fu/scripts/carved-logo.scm
 * plug-ins/script-fu/scripts/chip-away.scm
 * plug-ins/script-fu/scripts/chrome-it.scm
 * plug-ins/script-fu/scripts/coffee.scm
 * plug-ins/script-fu/scripts/comic-logo.scm
 * plug-ins/script-fu/scripts/coolmetal-logo.scm
 * plug-ins/script-fu/scripts/crystal-logo.scm
 * plug-ins/script-fu/scripts/frosty-logo.scm
 * plug-ins/script-fu/scripts/glossy.scm
 * plug-ins/script-fu/scripts/hsv-graph.scm
 * plug-ins/script-fu/scripts/land.scm
 * plug-ins/script-fu/scripts/lava.scm
 * plug-ins/script-fu/scripts/mkbrush.scm
 * plug-ins/script-fu/scripts/rendermap.scm
 * plug-ins/script-fu/scripts/select-to-brush.scm
 * plug-ins/script-fu/scripts/select-to-pattern.scm
 * plug-ins/script-fu/scripts/sota-chrome-logo.scm
 * plug-ins/script-fu/scripts/spyrogimp.scm
 * plug-ins/script-fu/scripts/starburst-logo.scm
 * plug-ins/script-fu/scripts/starscape-logo.scm
 * plug-ins/script-fu/scripts/t-o-p-logo.scm
 * plug-ins/script-fu/scripts/test-sphere.scm
 * plug-ins/script-fu/scripts/textured-logo.scm: use the new
 opacity, paint_mode, brush, pattern, gradient, palette and font
 accessors.

2004-09-23  Sven Neumann  <sven@gimp.org>

 Converted the last bunch of scripts to the new context API:

 * plug-ins/script-fu/scripts/[s-z]*.scm

2004-09-23  Sven Neumann  <sven@gimp.org>

 Converted more scripts to the new context API:

 * plug-ins/script-fu/scripts/glossy.scm
 * plug-ins/script-fu/scripts/hsv-graph.scm
 * plug-ins/script-fu/scripts/image-structure.scm
 * plug-ins/script-fu/scripts/perspective-shadow.scm
 * plug-ins/script-fu/scripts/pupi-button.scm
 * plug-ins/script-fu/scripts/rendermap.scm
 * plug-ins/script-fu/scripts/ripply-anim.scm

2004-09-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/scripts/hsv-graph.scm: 

 * tools/pdbgen/pdb/context.pdb: oops, should probably pop, not
 push a context in gimp_context_pop().

 * app/pdb/context_cmds.c: regenerated.

 * plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the
 brush description, simply use the name choosen by the user.

2004-09-23  Sven Neumann  <sven@gimp.org>

 Converted the next bunch of scripts to the new context API:

 * plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context.
 Removed code that used to restore the context values changed by
 the scripts.

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv):
 removed warning about entering a dead code path. That path is not
 dead at all :)

2004-09-23  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/context.pdb: added accessors for the context's
 brush, pattern, gradient, palette and brush. Deprecation of old
 functions will follow. Fixes gimp-context-set-background wrapper.
 Cleanup.

 * tools/pdbgen/pdb/patterns.pdb
 * libgimp/gimpbrushes.h: minor fixes.

 * app/pdb/context_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/patterns_cmds.c
 * libgimp/gimpcontext_pdb.[ch]: regenerated.

2004-09-23  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics.

2004-09-22  Kevin Turner  <acapnotic@twistedmatrix.com>

 * plug-ins/pygimp/gimpfu.py (register): clean up errors in
 parameter checking.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode
 functions...

 * tools/pdbgen/pdb/context.pdb: ...and added them here.

 * app/pdb/procedural_db.c: added them to the pdb_compat hash table.

 * libgimp/Makefile.am
 * libgimp/gimpbrushes.[ch]: new files with compat functions
 which call the gimp_context_*() functions.

 * libgimp/gimp.h: changed accordingly.

 * app/pdb/brushes_cmds.c
 * app/pdb/context_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpbrushes_pdb.[ch]
 * libgimp/gimpcontext_pdb.[ch]: regenerated.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/groups.pl
 * tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group...

 * tools/pdbgen/pdb/context.pdb: and added its functions to the
 "Context" namespace instead.

 * app/pdb/Makefile.am
 * app/pdb/palette_cmds.c: removed.

 * app/pdb/procedural_db.c: added them to the pdb_compat hash table.

 * libgimp/Makefile.am
 * libgimp/gimppalette_pdb.[ch]: removed.

 * libgimp/gimppalette.[ch]: new files holding compat functions
 which call gimp_context_*() functions.

 * libgimp/gimp.h
 * libgimp/gimpui.c: changed accordingly.

 * app/pdb/context_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimp_pdb.h
 * libgimp/gimpcontext_pdb.[ch]: regenerated.

 * plug-ins/MapObject/mapobject_image.c
 * plug-ins/MapObject/mapobject_preview.c
 * plug-ins/common/apply_lens.c
 * plug-ins/common/blinds.c
 * plug-ins/common/borderaverage.c
 * plug-ins/common/checkerboard.c
 * plug-ins/common/colortoalpha.c
 * plug-ins/common/cubism.c
 * plug-ins/common/exchange.c
 * plug-ins/common/film.c
 * plug-ins/common/gif.c
 * plug-ins/common/grid.c
 * plug-ins/common/mapcolor.c
 * plug-ins/common/mblur.c
 * plug-ins/common/mng.c
 * plug-ins/common/mosaic.c
 * plug-ins/common/papertile.c
 * plug-ins/common/png.c
 * plug-ins/common/polar.c
 * plug-ins/common/semiflatten.c
 * plug-ins/common/sinus.c
 * plug-ins/common/sparkle.c
 * plug-ins/common/vpropagate.c
 * plug-ins/common/warp.c
 * plug-ins/common/whirlpinch.c
 * plug-ins/gfig/gfig-style.c
 * plug-ins/gfli/gfli.c
 * plug-ins/ifscompose/ifscompose.c
 * plug-ins/maze/handy.c
 * plug-ins/pagecurl/pagecurl.c
 * plug-ins/pygimp/gimpmodule.c
 * plug-ins/script-fu/scripts/*.scm: changed accordingly.

2004-09-22  Sven Neumann  <sven@gimp.org>

 * app/actions/view-actions.c (view_zoom_actions): mark menu label
 as translatable (bug #153456).

2004-09-22  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/siod-wrapper.c
 * plug-ins/script-fu/scripts/mkbrush.scm
 * plug-ins/script-fu/scripts/select-to-brush.scm
 * plug-ins/script-fu/scripts/select-to-pattern.scm: applied a
 patch from Kevin Cozens that adds constants for the directory
 names exposed by libgimpbase. Fixes bug #153327.

2004-09-22  Sven Neumann  <sven@gimp.org>

 Converted the first bunch of Script-Fu to the new context API:

 * plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context.
 Removed code that used to restore the context values changed by
 the scripts.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init):
 removed assertion about proc_rec != NULL because that happens
 when query()ing and init()int plug-ins.

 Replaced "context" by "main_context" plus "context_stack".

 * app/plug-in/plug-in-context.c: implement plug_in_context_push()
 and plug_in_context_pop().

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c: changed accordingly.

 * tools/pdbgen/pdb/context.pdb: use the return values of
 plug_in_context_push() and _pop().

 * app/pdb/context_cmds.c: regenerated.

 * plug-ins/script-fu/scripts/test-sphere.scm: use
 gimp-context-push and gimp-context-pop instead of remembering the
 old values for FG, BG etc.

2004-09-22  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/pdb/context.pdb: new files that will hold context
 related PDB functions.

 * tools/pdbgen/groups.pl
 * app/pdb/Makefile.am
 * app/pdb/context_cmds.c
 * app/pdb/internal_procs.c
 * app/pdb/progress_cmds.c
 * libgimp/gimp_pdb.h
 * libgimp/gimpcontext_pdb.[ch]: (re)generated.

 * app/plug-in/Makefile.am
 * app/plug-in/plug-in-context.[ch]: new files that will hold code
 that implements a context stack in the plug-in's proc-frame.

 * app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame().

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c: use the new function instead of
 duplicating it all over the place.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/Makefile.am
 * app/plug-in/plug-in-proc.[ch]: removed...
 * app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

 * app/plug-in/plug-in-def.[ch]
 * app/plug-in/plug-in-message.[ch]
 * app/plug-in/plug-in-progress.[ch]
 * app/plug-in/plug-in-rc.[ch]
 * app/plug-in/plug-in-run.[ch]
 * app/plug-in/plug-in.[ch]
 * app/plug-in/plug-ins.[ch]
 * app/actions/plug-in-actions.c
 * app/actions/plug-in-commands.c
 * app/file/file-open.[ch]
 * app/file/file-save.[ch]
 * app/file/file-utils.[ch]
 * app/gui/gui-vtable.c
 * app/menus/plug-in-menus.c
 * app/widgets/gimpfiledialog.c
 * app/widgets/gimpfileprocview.c
 * app/widgets/gimppluginaction.c
 * app/xcf/xcf.c
 * tools/pdbgen/pdb/fileops.pdb
 * tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
 minor cosmetic cleanups.

 * app/pdb/fileops_cmds.c
 * app/pdb/plug_in_cmds.c: regenerated.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimplayertreeview.c
 (gimp_layer_tree_view_floating_selection_changed): removed the
 hack that was displaying "Floating Selection" instead of the
 floating layer's real name.

 * app/core/gimplayer.c: implement GimpViewable::get_description()
 instead and special case floating selections with a two-line
 text that contains "Floating Selection".

 * app/core/gimplayer-floating-sel.c
 * app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
 when it changes its state from floating to normal or vice versa
 so the views can update accordingly.

 * app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

 * app/tools/gimpeditselectiontool.c:
 s/"Floating Layer"/"Floating Selection"/.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/Makefile.am
 * app/plug-in/plug-in-proc-frame.[ch]: new files containing
 utility functions for initializing/freeing PlugInProcFrames.
 Added the progress stuff to the proc_frame.

 * app/plug-in/plug-in.[ch]: removed the progress stuff from the
 PlugIn struct and use the new proc_frame utility functions.

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c
 * app/plug-in/plug-in-run.c: changed accordingly.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 Prepare for enabling private contexts for plug-ins and scripts:

 * app/plug-in/plug-in.[ch]: removed the "context" member from
 the PlugIn struct and added it to PlugInProcFrame instead.

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c
 * app/plug-in/plug-in-run.c: changed accordingly.

2004-09-22  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c: moved the preview to the left.

2004-09-22  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-types.h
 * app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which
 contains the ProcRecord, the proc's GMainLoop and its return
 values.

 Use the same struct for the plug-in's main proc and its
 temp_procs, so we finally have one set of return values per call
 frame, and not just one per plug-in.

 Added plug_in_proc_frame_push()/pop() and changed
 plug_in_main_loop[_quit]() accordingly.

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c
 * app/plug-in/plug-in-run.c: changed accordingly.

2004-09-22  Sven Neumann  <sven@gimp.org>

 * app/text/gimptextlayout.c (gimp_text_get_pango_context):
 workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug
 #148997). Based on a patch by Robert Ögren.

2004-09-22  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpviewabledialog.c: removed the prelit event box
 from the header frame, use a smaller font for the subtitle,
 removed the separator.

 * app/dialogs/preferences-dialog.c: removed the prelit event box
 from the header frame. Perhaps we should have subtitles here with
 a more verbose description of the settings page?

2004-09-21  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-actions.c (file_actions): resolved conflicting
 mnemonics.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png
 to gimp-splash.png.

 * data/images/gimp-splash.png: new splash, courtesy of Dave Neary.

 * app/gui/splash.c: look for gimp-splash.png in the users
 directory, then in the systemwide images directory.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-server.c: got rid of two the global
 file descriptor sets. Use the client hash-table instead.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-server.c: enabled build of the
 Script-Fu server for the Win32 platform using the winsock API.

 * plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32.

 * plug-ins/script-fu/script-fu-console.c
 * plug-ins/script-fu/script-fu.c
 * plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code
 that isn't needed any longer.

2004-09-21  Michael Natterer  <mitch@gimp.org>

 For the sake of completeness, added a GUI for the hidden
 "Open as Layer" feature:

 * app/actions/file-actions.c
 * app/actions/file-commands.[ch]: added "file-open-as-layer"
 action and callback. Abuse the "gimage" field of GimpFileDialog to
 indicate layer opening (it's otherwise unused for file-open).

 * app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
 open the selected files as layers for that image.

 * app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.

 * menus/image-menu.xml.in: added it to the menu.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c (save_dialog): let the dialog collapse
 with the expander by making it not resizable.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-close.c
 (gimp_display_shell_close_dialog): resolved a mnemonics collision.

2004-09-21  Dave Neary  <bolsh@gimp.org>

 * plug-ins/common/psd.c: Correctly set overlay, hard light and
 soft light modes from .psd files. Fixes bug #153229.

2004-09-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as
 a workaround for bug #143300.

2004-09-20  Maurits Rijk  <m.rijk@chello.nl>

 * plug-ins/imagemap/imap_cmd_guides.c
 * plug-ins/imagemap/imap_default_dialog.c
 * plug-ins/imagemap/imap_menu.c
 * plug-ins/imagemap/imap_preferences.c
 * plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't
 fully work yet. Bug #136713 now becomes an enhancement request.

2004-09-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate
 for darkening" by default, some minor cleanups.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/dialogs-constructors.c: removed useless #includes.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * app/actions/buffers-commands.c
 * app/actions/file-commands.c
 * app/actions/layers-commands.c
 * app/actions/plug-in-actions.c
 * app/actions/tools-actions.c: removed useless #includes, cleanup.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory
 parameter and removed inclusion on "menus/menus.h".

 * app/menus/menus.[ch] (menus_init): added GimpActionFactory
 parameter and removed inclusion of "actions/actions.h".

 * app/gui/gui.c (gui_restore_callback): pass the factories to the
 above functions.

2004-09-20  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version number to 2.1.6.

2004-09-20  DindinX  <dindinx@gimp.org>

 * plug-ins/common/deinterlace.c: added a preview. Not sure if it is
 really useful...

2004-09-20  DindinX  <dindinx@gimp.org>

 * plug-ins/common/shift.c: added a preview.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events):
 removed "case GDK_CONFIGURE" because it's not needed and did
 "break" instead of "return FALSE", causing random color changes
 when resizing and initially showing the widget.

2004-09-20  Sven Neumann  <sven@gimp.org>

 * Made 2.1.5 release.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks.

 (gimp_2_1_LDADD)
 (gimp_console_2_1_LDADD): reordered .a files correctly. The core
 seems to be cleaned up enough to have proper dependencies now.

2004-09-20  Michael Natterer  <mitch@gimp.org>

 * app/actions/channels-commands.c
 * app/actions/vectors-commands.c: removed massive code duplication
 by factoring out the code that creates the "New Channel/Path" and
 "Edit Channel/Path Attributes" dialogs out to utility functions.
 GUI spacing and Code cleanup.

 * app/actions/layers-commands.c: minor GUI spacing and code
 cleanup.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * app/base/tile-manager.c (tile_manager_get_memsize): count valid
 tiles, not dirty ones.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c: some tweaks to the dialog layout.

2004-09-19  Michael Natterer  <mitch@gimp.org>

 * app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a
 GtkRadioAction callback but behaved like a GtkToggleAction
 callback. Fixes bug #152948.

2004-09-19  DindinX  <dindinx@gimp.org>

 * plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a
 very complicated homemade preview.  Many small changes in the code
 too, and some cleanups. I hope I didn't break anything.

2004-09-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
 by my previous commit -- no functional change.

2004-09-19  Sven Neumann  <sven@gimp.org>

 Improved undo memory calculation for paint operations (bug #153035):

 * app/base/tile-manager.[ch] (tile_manager_get_memsize): added a
 "gboolean sparse" parameter to get more accurate results for
 sparse tile-managers.

 * app/core/gimpbuffer.c
 * app/core/gimpdrawable.c
 * app/core/gimpimage-undo-push.c
 * app/core/gimpimage.c
 * app/core/gimplayer.c
 * app/core/gimpprojection.c: changed accordingly.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h.

2004-09-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/tools/gimppaintoptions-gui.c: rearrange tool options as
 described in bug #153014.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
 handling of too many error messages.

2004-09-19  Sven Neumann  <sven@gimp.org>

 Try to make floating selections more obvious:

 * app/widgets/gimplayertreeview.c
 (gimp_layer_tree_view_floating_selection_changed): always display
 "Floating Selection" as the name for a floating selection.

 * app/core/gimpselection.c (gimp_selection_float): call the new
 layer "Selection" instead of "Floating Selection". This is what
 will be displayed if the FS is turned into a layer.

 * app/actions/layers-commands.c (layers_edit_layer_query): don't
 special case floating selections here.

 * app/core/gimplayer-floating-sel.c: cosmetics.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c (ps_open): applied a patch by Peter
 Kirchgessner that solves a problem with the recognition of the
 bounding box. Fixes bug #152829.

2004-09-19  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc
 comment.

2004-09-18  Simon Budig  <simon@gimp.org>

 * libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0,
 so that the entry accepts hex colors starting with "#" again.
 Untabbified.

2004-09-18  Manish Singh  <yosh@gimp.org>

 * app/Makefile.am: remove LDFLAGS references to now private
 file_open_dialog_show, file_open_location_dialog_show, and
 file_save_dialog_show.

2004-09-18  Sven Neumann  <sven@gimp.org>

 * app/actions/qmask-commands.c
 * libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup.

 * app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always
 set gimage->qmask_color regardless of the qmask state.

 * libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set
 the type before setting the color.

2004-09-17  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcomponenteditor.c
 (gimp_component_editor_renderer_update): use
 gimp_component_editor_get_iter() instead of duplicating its code.

2004-09-17  Simon Budig  <simon@gimp.org>

 * app/widgets/gimpbrusheditor.[ch]: Added a slider for the
 brush spacing to the brush editor. Should make it more obvious
 how to change it.

2004-09-17  Sven Neumann  <sven@gimp.org>

 * app/core/gimp-edit.c (gimp_edit_paste): based on a patch from
 Joao S. O. Bueno: Ensure that the pasted layer is always within
 the image, if it fits and aligned at top left if it doesn't.
 Fixes bug #142944.

2004-09-16  Sven Neumann  <sven@gimp.org>

 * INSTALL: updated.

2004-09-16  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic):
 applied a patch by Joao S. O. Bueno that fixes bug #152820.

2004-09-16  Dave Neary  <bolsh@gimp.org>

 * plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin
 Cozens which reinstates corona. Fixes bug #142282.

2004-09-16  Michael Natterer  <mitch@gimp.org>

 * configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.

 * app/gui/gui.c: changed accordingly.

 * app/sanity.c: ditto. Added check for GLib and put each check
 into its own utility function. Enabled #if 0'ed check for
 FreeType >= 6.2.7.

 * app/widgets/gimpactiongroup.c
 * app/widgets/gimpcursor.c
 * app/widgets/gimpselectiondata.c
 * app/widgets/gimpuimanager.c
 * app/widgets/gimpwidgets-utils.c: removed workarounds for library
 versions we refuse to start with.

2004-09-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
 order of DND dests so "text/uri-list" is preferred again after my
 DND change of 2004-06-29. Fixes dropping of multiple files.

2004-09-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcomponenteditor.[ch]: set the viewable
 renderer's "renderer" property to NULL when clearing the
 view to work around bug #149906.

2004-09-16  Sven Neumann  <sven@gimp.org>

 * app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift
 with a binary and. Should be unnoticeably faster ;)

2004-09-16  Michael Natterer  <mitch@gimp.org>

 * app/pdb/procedural_db.c: removed #if 0'ed code, took assignments
 out of if()-conditions, minor cleanup.

2004-09-16  Simon Budig  <simon@gimp.org>

 * app/core/gimpscanconvert.c: Implemented an own rendering
 callback for libart and use it instead of art_gray_svp_aa().
 This now handles non-antialiased scan conversions itself. It
 also basically shows the way to implement a LUT for the
 scan conversion.

2004-09-16  Sven Neumann  <sven@gimp.org>

 * app/dialogs/quit-dialog.c: removed code that isn't needed any
 longer now that the dialog is a singleton.

2004-09-15  DindinX  <david@dindinx.org>

 * plug-ins/common/mblur.c: fix the preview for the zoom blur mode.

2004-09-15  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c
 (gimp_preview_area_[draw|blend|mask]): fixed code that handles
 drawing outside of the preview area.

 * plug-ins/common/unsharp.c (preview_update): draw the preview
 directly from the pixel region.

2004-09-15  Manish Singh  <yosh@gimp.org>

 * modules/controller_linux_input.c: use guint16 instead of __u16.
 Should fix bug #152746.

2004-09-15  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.[ch]
 * libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to
 gimp_drawable_preview_draw_buffer() and added a rowstride
 parameter. Added new functions gimp_drawable_preview_get_drawable()
 and gimp_drawable_preview_draw_region().

 * plug-ins/common/mblur.c: added a preview that uses the
 shadow tiles as the preview buffer and draws using the new
 gimp_drawable_preview_draw_region() API.

 * plug-ins/common/photocopy.c
 * plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region().

 * plug-ins/common/cartoon.c
 * plug-ins/common/despeckle.c
 * plug-ins/common/edge.c
 * plug-ins/common/gauss.c
 * plug-ins/common/grid.c
 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/sharpen.c
 * plug-ins/common/sobel.c
 * plug-ins/common/spread.c
 * plug-ins/common/struc.c
 * plug-ins/common/unsharp.c
 * plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer().

2004-09-15  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
 vectors-visible and -liked actions as well as for the layer mask
 property action.

 * app/actions/drawable-actions.c
 * app/actions/vectors-actions.c: use them.

 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]: ditto. Use
 GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
 "paint_mode" by "mode" in all action and function/variable names
 because this is the layer mode, not a paint mode.

 * app/actions/channels-commands.c
 * app/actions/layers-commands.c
 * app/actions/vectors-commands.c: set the "activates-default"
 property on the name entry in all "New Foo" and "Edit Foo
 Attributes" dialogs except in the "New Layer" dialog.
 Addresses bug #148026.

 * menus/image-menu.xml.in: added a (commented out) layer
 properties menu containing all the new actions.

2004-09-15  Michael Natterer  <mitch@gimp.org>

 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]: added actions and callbacks
 "layers-preserve-transparency" and
 "layers-paint-mode-first,last,previous,next". Update the "active"
 state of the recently added layer mask property actions in
 layers_actions_update().

 * app/actions/drawable-actions.c
 * app/actions/drawable-commands.[ch]: added actions and callbacks
 for "drawable-visible" and "drawable-linked". Fixes bug #152597.

 * app/actions/vectors-actions.c
 * app/actions/vectors-commands.[ch]: same here ("vectors-visible"
 and "vectors-linked").

 * app/widgets/gimplayertreeview.c
 (gimp_layer_tree_view_preserve_button_toggled): flush the image
 so the new actions are updated. Compress preserve_trans undos.

 * menus/image-menu.xml.in: added the layer mask property actions
 to the Layers/Mask submenu.

 * menus/layers-menu.xml: reordered the mask property actions
 to have the same order as in the image menu.

2004-09-15  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcontainertreeview.c
 (gimp_container_tree_view_menu_position): improved the fix for bug
 #152662 and removed trailing whitespace.

2004-09-15  Nathan Summers  <rock@gimp.org>

 * app/widgets/gimpcontainertreeview.c
 (gimp_container_tree_view_menu_position): clamp the popup menu's Y
 position to the visible area of the GtkTreeView.  Fixes #152662.

2004-09-14  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpquerybox.c: set the "activates-default"
 property on the entries in all query boxes so hitting "return"
 confirms them. Addresses bug #148026.

2004-09-14  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpbufferview.c: simplified the code which deals
 with the global_buffer's preview. The new buffer view renderer
 does the aspect ratio magic all by itself now.

 * app/actions/image-commands.h: removed trailing whitespace.

2004-09-14  Michael Natterer  <mitch@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
 which knows how to preserve a GimpBuffer's aspect ratio if the
 view's aspect ratio is different.

 * app/widgets/gimpviewrenderer-utils.c
 (gimp_view_renderer_type_from_viewable_type): use it for viewables
 of type GimpBuffer. Fixes bug #152531

2004-09-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/flarefx.c
 * plug-ins/common/nova.c: embed the preview into a sunken frame
 and put it into the upper left corner of the dialog.

2004-09-14  Sven Neumann  <sven@gimp.org>

 * app/dialogs/dialogs-constructors.[ch]
 * app/dialogs/dialogs.c
 * app/gui/gui.c: let the dialog factory handle the quit dialog
 as singleton. Fixes bug #151914.

 * app/dialogs/quit-dialog.c: added a warning here. We need a
 container of dirty images for the above change to work correctly.

2004-09-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data"
 toggle insensitive when no EXIF data is present (bug #140042).

 * app/display/gimpdisplayshell-close.c: as suggested by the HIG,
 ask the user to save the image when the last display is being
 closed. Addresses some issues raised in bug #106726.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 * app/app_procs.c (app_run): install the message handler for the
 "Gimp-Dialogs" domain.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-commands.c: resurrected file_open_dialog_show()
 and file_save_dialog_show() as private utility functions to get
 rid of code duplication.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 Manage the file-save dialog using the dialog factory and stop
 making menu items insensitive while it is open. Fixes bug #81407.

 * app/dialogs/Makefile.am
 * app/dialogs/file-dialog-utils.[ch]: removed these files.

 * app/dialogs/file-save-dialog.[ch]: removed functions
 file_save_dialog_show() and file_save_a_copy_dialog_show() and
 changed internal function file_save_dialog_create() to
 file_save_dialog_new().

 * app/dialogs/dialogs.c
 * app/dialogs/dialogs-constructors.[ch]: made it completely
 managed by the dialog factory.

 * app/actions/file-commands.c: create it using the dialog
 factory. Attach it to the image so we open only one save
 dialog per image.

 * app/dialogs/file-open-dialog.c: added precondition checks
 to file_open_dialog_new().

2004-09-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c: some code cleanup.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 * app/dialogs/file-open-dialog.[ch]: removed function
 file_open_dialog_show() and changed internal function
 file_open_dialog_create() to file_open_dialog_new().

 * app/dialogs/dialogs.c
 * app/dialogs/dialogs-constructors.[ch]: made it completely
 managed by the dialog factory.

 * app/actions/file-commands.c: create it using the dialog factory.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 * configure.in
 * app/Makefile.am: added new directory app/dialogs and link
 libappdialogs.c into the gimp binary.

 * app/gui/Makefile.am
 * app/gui/gui-types.h
 * app/gui/gui-vtable.c
 * app/gui/gui.c

 * app/gui/about-dialog.[ch]
 * app/gui/authors.h
 * app/gui/color-notebook.[ch]
 * app/gui/convert-dialog.[ch]
 * app/gui/dialogs-constructors.[ch]
 * app/gui/dialogs.[ch]
 * app/gui/file-dialog-utils.[ch]
 * app/gui/file-new-dialog.[ch]
 * app/gui/file-open-dialog.[ch]
 * app/gui/file-open-location-dialog.[ch]
 * app/gui/file-save-dialog.[ch]
 * app/gui/grid-dialog.[ch]
 * app/gui/info-dialog.[ch]
 * app/gui/info-window.[ch]
 * app/gui/module-browser.[ch]
 * app/gui/offset-dialog.[ch]
 * app/gui/palette-import-dialog.[ch]
 * app/gui/preferences-dialog.[ch]
 * app/gui/quit-dialog.[ch]
 * app/gui/resize-dialog.[ch]
 * app/gui/resolution-calibrate-dialog.[ch]
 * app/gui/stroke-dialog.[ch]
 * app/gui/tips-dialog.[ch]
 * app/gui/tips-parser.[ch]
 * app/gui/user-install-dialog.[ch]: removed these files...

 * app/dialogs/Makefile.am
 * app/dialogs/dialogs-types.h

 * app/dialogs/*.[ch]: ...and added them here. Changed some
 filenames like module-browser -> module-dialog.

 * app/app_procs.c
 * app/actions/actions-types.h
 * app/actions/actions.c
 * app/actions/dialogs-actions.c
 * app/actions/dialogs-commands.c
 * app/actions/dockable-commands.c
 * app/actions/drawable-commands.c
 * app/actions/edit-commands.c
 * app/actions/file-commands.c
 * app/actions/gradient-editor-commands.c
 * app/actions/image-commands.c
 * app/actions/layers-commands.c
 * app/actions/palettes-commands.c
 * app/actions/select-commands.c
 * app/actions/templates-commands.c
 * app/actions/templates-commands.h
 * app/actions/vectors-commands.c
 * app/actions/view-commands.c
 * app/display/gimpdisplayshell-cursor.c
 * app/display/gimpdisplayshell-title.c
 * app/display/gimpdisplayshell.[ch]
 * app/tools/gimpcroptool.c
 * app/tools/gimpperspectivetool.c
 * app/tools/gimprotatetool.c
 * app/tools/gimpscaletool.c
 * app/tools/gimpsheartool.c
 * app/tools/gimptransformtool.[ch]
 * app/tools/gimpvectortool.c
 * app/widgets/gimpcolormapeditor.[ch]
 * app/widgets/gimpcolorpanel.c
 * app/widgets/gimpgradienteditor.[ch]
 * app/widgets/gimppaletteeditor.[ch]
 * app/widgets/gimptoolbox-color-area.c
 * menus/toolbox-menu.xml.in
 * tools/authorsgen/authorsgen.pl: changed accordingly.

2004-09-13  Michael Natterer  <mitch@gimp.org>

 Restore binary compatibility of the wire protocol that was
 broken by the recent GPConfig changes:

 * libgimpbase/gimpprotocol.[ch] (struct _GPConfig)
 (_gp_config_read)
 (_gp_config_write): argh, we can't use the two bytes padding
 because that's just a binary compatible struct change, but inserts
 two bytes into the byte stream that goes over the wire. Use the
 first two bytes of the former "gdouble gamma" instead.

 * app/plug-in/plug-in-run.c (plug_in_run)
 * libgimp/gimp.c (gimp_config): changed accordingly.

2004-09-13  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
 look at the LANGUAGE environment variable if the locale is not "C".

2004-09-13  Simon Budig  <simon@gimp.org>

 * app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
 /me hides embarrassed in a corner...   :)

2004-09-13  Simon Budig  <simon@gimp.org>

 * app/tools/gimpcroptool.c: Fix warnings and coding style.

2004-09-12  Nathan Summers  <rock@gimp.org>

 * app/tools/gimpcroptool.c: disable crop and resize buttons while the
 operation is being processed.  Fixes #152372.

2004-09-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/aa.c (aa_dialog): use a combo box for format
 selection.

2004-09-12  Sven Neumann  <sven@gimp.org>

 * libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing
 whitespace.

2004-09-12  DindinX  <david@dindinx.org>

 * libgimp/gimppixelrgn.c: some more fixes by nomis.

2004-09-12  DindinX  <david@dindinx.org>

 * libgimp/gimppixelrgn.c: nomis helped me to make some correction to
 the documentation.

2004-09-12  DindinX  <david@dindinx.org>

 * libgimp/gimppixelrgn.c: more documentation.

2004-09-11  DindinX  <david@dindinx.org>

 * plug-ins/common/edge.c: added a default value (TRUE) for the
 update_preview toggle.

 * plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is
 much more useful now.

2004-09-11  DindinX  <david@dindinx.org>

 * libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel
 region related functions. (work in progress)

2004-09-11  Simon Budig  <simon@gimp.org>

 * app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
 gimp_dialog_factories_toggle to make it possible to ensure a visible
 toolbox.

 * app/actions/dialogs-commands.c: Use the new parameter to ensure
 toolbox visibility after the last image window closes.

 * app/display/gimpdisplayshell-callbacks.c: Changed accordingly.

 Fixes bug #137057 (the discussion is in bug #152285)

2004-09-11  DindinX  <david@dindinx.org>

 * plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of
 code and much more features!

2004-09-11  DindinX  <david@dindinx.org>

 * plug-ins/common/oilify.c: some code cleanup and small optimisations.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/xpm.c (query): fixed spelling.

2004-09-10  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/widgets/gimperrorconsole.c: fix typo

2004-09-10  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcolorselect.c: untabified, removed useless
 inclusion of <gdk/gdkkeysyms.h>.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea.
 Destroy the GdkGC in unrealize() instead of in finalize().

2004-09-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainertreeview-dnd.c
 (gimp_container_tree_view_drop_status): always call
 gdk_drag_status() before returning FALSE.

 (gimp_container_tree_view_drag_motion): never return FALSE, an
 impossible drop location is now reported by calling
 gdk_drag_status() above. Always returning TRUE makes sure
 gimp_container_tree_view_drag_leave() is called unconditionally
 and can remove the scroll_timeout set in drag_motion().

 Fixes bug #152193 and many other obscure DND crashes caused by the
 scroll_timeout being invoked after the widget is destroyed.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely
 based on a patch attached to bug #151912.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb):
 also handle GRAY and GRAYA thumbnails.

 * tools/pdbgen/pdb/drawable.pdb
 * tools/pdbgen/pdb/image.pdb: corrected documentation for
 _gimp_drawable_thumbnail() and _gimp_image_thumbnail().

 * app/pdb/drawable_cmds.c
 * app/pdb/image_cmds.c
 * libgimp/gimpdrawable_pdb.c
 * libgimp/gimpimage_pdb.c: regenerated.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c: fixed positioning of the
 navigation marker and handling of motion events.

2004-09-10  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c
 * libgimpwidgets/gimppreviewarea.c: documented new functions.

2004-09-09  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c
 * libgimpwidgets/gimppreview.[ch]: added a navigation popup
 similar to the one in the image window. Needs some more work.

2004-09-09  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c: added a utility function
 gimp_preview_area_queue_draw(), which queue the right part of the
 preview to be redrawn. And use it in all the drawing functions. This
 fix a problem where the preview wasn't updated correctly after a
 resize.

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/cartoon.c
 * plug-ins/common/despeckle.c
 * plug-ins/common/gauss.c
 * plug-ins/common/grid.c
 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/photocopy.c
 * plug-ins/common/sel_gauss.c
 * plug-ins/common/sharpen.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/struc.c
 * plug-ins/common/unsharp.c: pack all drawable previews expanding.
 Also did some general cleanups like consistently naming the dialog
 variable "dialog" and the main vbox "main_vbox".

2004-09-09  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL
 layouts.

2004-09-09  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size
 and center the preview area if its allocation extends the maximum.

 * libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the
 toggle button out of the table and put the table into an aspect
 frame. Added an API to set the preview boundaries. Set the maximum
 size of the GimpPreviewArea from that function.

 * libgimpwidgets/gimpwidgets.def: added new entries.

 * libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds().

 * plug-ins/common/gauss.c: pack the preview widget so that it
 resizes with the dialog.

2004-09-09  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend)
 (gimp_preview_area_mask): optimized the case where both buffers have
 the same alpha for a given pixel.

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpviewrendererbrush.c
 * app/widgets/gimpviewrendererdrawable.c
 * app/widgets/gimpviewrenderergradient.c
 * app/widgets/gimpviewrendererimage.c
 * app/widgets/gimpviewrendererimagefile.c
 * app/widgets/gimpviewrendererlayer.c
 * app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
 g_type_name(dialog_type) instead of just "pdb dialog" as name for
 the dialog's private context.

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * app/gui/convert-dialog.[ch] (convert_dialog_new): changed
 GimpDisplay* parameter to GimpProgress* because that's what it's
 used for.

 * app/actions/image-commands.c (image_convert_cmd_callback):
 changed accordingly.

 * app/gui/convert-dialog.c: massively cleaned up internals. Use a
 GimpViewableButton + GimpContainerEntry combo as in text options
 for selecting the custom palette. Use a filtered container which
 contains only palettes with a maximum of 256 colors.
 Fixes bug #136574

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * app/gui/file-open-location-dialog.[ch]: changed
 file_open_location_dialog_show() to
 file_open_location_dialog_new() and return the dialog.

 * app/gui/dialogs.c
 * app/gui/dialogs-constructors.[ch]: added a constructor for it
 and let the dialog factory manage it entirely.

 * app/actions/file-commands.c
 (file_open_location_dialog_cmd_callback): use the dialog factory
 to create it.

2004-09-09  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdialogfactory.c
 (gimp_dialog_factory_dialog_new_internal): renamed parameter
 "gboolean raise_if_found" to "return_existing" and added
 additional parameter "gboolean present".

 (gimp_dialog_factory_dialog_new)
 (gimp_dialog_factory_dialog_raise)
 (gimp_dialog_factory_dockable_new): pass both parameters (passing
 "present" as "raise_if_found" was not quite correct).

2004-09-08  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c: fixed a stupid typo.

2004-09-08  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill):
 optimized solid color fills.

2004-09-08  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c: factored out common code.
 Reduced indentation level by closing a switch earlier.

2004-09-08  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend)
 use gimp_preview_area_draw when the opacity is 0 or 255, instead of
 duplicating code.

2004-09-07  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.def: added new entries.

 * libgimpwidgets/test-preview-area.c: fit output into 80 columns.

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some
 code cleanup.

2004-09-07  DindinX  <david@dindinx.org>

 * libgimpwidgets/test-preview-area.c: added some tests for
 gimp_preview_area_blend() and gimp_preview_area_mask().

2004-09-07  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c
 * libgimpwidgets/gimppreviewarea.h: added two functions:
 gimp_preview_area_blend() to draw the blending of two buffers with
 an opacity parameter, and gimp_preview_area_mask() to draw the
 blending of two buffers, with a mask buffer. The code still needs some
 polish, though.

 * libgimp/gimpdrawablepreview.c
 * libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in
 gimp_drawable_preview_draw(), so the previews are now much more
 accurate (respecting the selection, if any).

 Also made the buf parameter of gimp_drawable_preview_draw() a pointer
 to constants.

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-draw.c
 (gimp_display_shell_draw_grid): #define the constant crosshair
 size for the INTERSECTION grid style instead of using an eeky
 "const gint".

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * app/gui/dialogs.c (toplevel_entries): added a foreign entry
 "gimp-file-open-loaction-dialog".

 * app/gui/file-open-location-dialog.c: register the dialog
 with the toplevel dialog factory so it remembers its position.

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c
 * app/actions/context-commands.[ch]: applied a heavily modified
 patch from David Gowers which adds actions to modify the context's
 paint_mode. Fixes bug #151471.

 * menus/image-menu.xml.in: added them to the (commentd out)
 "Context" submenu.

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/edge.c: indentation and whitespace cleanup.

 * plug-ins/common/struc.c: minor coding style issues.

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/xwd.c (query): applied patch from Alan Horkan
 which improves the blurb and help texts. Fixes bug #151912.

 Unrelated: did coding style / indentation cleanup in the whole file.

2004-09-07  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
 simplified the code that selects an image file by its URI.

2004-09-07  Simon Budig  <simon@gimp.org>

 * app/widgets/gimpviewrendererbrush.c: Added an indicator for
 generated brushes. Pretty straightforward, suggestions for
 improvements are welcome.

2004-09-06  DindinX  <david@dindinx.org>

 * plug-ins/common/struc.c: added a preview.

2004-09-06  Simon Budig  <simon@gimp.org>

 * app/tools/gimpcroptool.c: reordered info_dialog_hide() and
 crop_tool_crop_image(), which avoids the repeated popping up
 of the info dialog and avoids a crash.

 Fixes bug #151712

2004-09-05  DindinX  <david@dindinx.org>

 * plug-ins/common/cartoon.c: use gimp_preview_invalidate() where
 appropriate.

 * plug-ins/common/photocopy.c: Added a preview.

2004-09-05  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version number to 2.1.5.

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
 the image file, not only the folder it lives in. Fixes bug #151638.

2004-09-05  DindinX  <david@dindinx.org>

 * plug-ins/common/cartoon.c: Added a preview.

2004-09-05  Simon Budig  <simon@gimp.org>

 * plug-ins/common/autocrop.c: fix handling of layers with an
 offset. Resize the image before cropping when the covered area
 of a layer is partially outside the image area. Make math more
 comprehensible.

2004-09-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/convmatrix.c
 * plug-ins/common/smooth_palette.c
 * plug-ins/flame/flame.c: renamed functions from doit() to
 something less silly.

2004-09-05  Sven Neumann  <sven@gimp.org>

 * Made 2.1.4 release.

2004-09-05  Simon Budig  <simon@gimp.org>

 * tools/pdbgen/pdb/image.pdb: improved documentation for
 gimp_image_resize_to_layers

 * libgimp/gimp.def: added gimp_image_resize_to_layers

 * app/pdb/image_cmds.c
 * libgimp/gimpimage_pdb.c: regenerated

2004-09-05  Simon Budig  <simon@gimp.org>

 * app/core/gimpimage-resize.[ch]: Implement function to resize
 the image to contain all layers completely. Untabified.

 * app/actions/image-actions.c
 * app/actions/image-commands.[ch]
 * app/widgets/gimphelp-ids.h
 * menus/image-menu.xml.in: Make it available in the GUI.

 * tools/pdbgen/pdb/image.pdb: Make it available in the PDB.

 * app/pdb/image_cmds.c
 * app/pdb/internal_procs.c
 * libgimp/gimpimage_pdb.[ch]: regenerated.

2004-09-04  DindinX  <david@dindinx.org>

 * plug-ins/common/noisify.c: ported to GimpDrawablePreview.

2004-09-04  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimp/gimp.def
 * libgimpbase/gimpbase.def
 * libgimpwidgets/gimpwidgets.def: added the check(erboard) related
 entries

2004-09-04  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to
 gimp_preview_area_menu_popup().

 * libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu().

2004-09-04  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreview.c: Changed the way we attach the preview
 area frame to the table so very small drawables don't cause a
 malicious bug.

2004-09-04  DindinX  <david@dindinx.org>

 * plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview.

2004-09-04  DindinX  <david@dindinx.org>

 * plug-ins/common/sharpen.c: ported to GimpDrawablePreview.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.[ch]: added
 gimp_preview_area_menu_popup(). Not completely finished yet...

 * libgimpwidgets/gimppreview.c: use the new function.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable):
 take care of setting the colormap for indexed drawables.

 * libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with
 the first mouse button only. We will need the other buttons.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/grid.c: ported to GimpDrawablePreview.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/plasma.c (plasma_dialog): left-align the preview.

 * plug-ins/common/grid.c (dialog): pack the preview as in other
 plug-in dialogs and embed it into a GtkFrame.

2004-09-03  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdevicestatus.c: removed "Configure input
 devices" button. Fixes bug #150177.

2004-09-03  Simon Budig  <simon@gimp.org>

 * app/gui/info-window.c: Applied modified patch by Kevin Cozens
 that implements a "Comments" tab in the image info dialog.

 Fixes bug #151719.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light
 and gray checks to get a checkerboard that matches the image window.

2004-09-03  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the
 never used "gdouble gamma" with 8 reserved gint8 and stuffed two
 gint8 behind "gint8 show_tool_tips" where they fit in in a binary
 compatible way due to 32bit aligning of the following "gint32
 min_colors". Use the latter ones for "check_size" and
 "check_type".

 * libgimpbase/gimpprotocol.c (_gp_config_read,write): changed
 accordingly to pass the new stuff over the wire.

 * app/plug-in/plug-in-run.c: ditto. Pass the transpareny values
 from GimpDisplayConfig to plug-ins.

 * libgimp/gimp.[ch] (gimp_config): remember the new config values.
 (gimp_check_size,type): new functions returning the new config values.

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init):
 use the new values to configure preview->area accordingly.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * libgimpbase/gimpchecks.h
 * libgimpbase/gimplimits.h: moved check size and check color
 defines. It makes a lot more sense to keep them in gimpchecks.h.

 * libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented.

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw):
 added a sanity check so we don't crash if the drawable pointer
 should ever be NULL here.

2004-09-02  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-*test.c: a regression test now
 iterates over 8388625 pixels per pass.

 * app/composite/gimp-composite-mmx.c
 * app/composite/gimp-composite-sse.c
 * app/composite/gimp-composite-sse2.c:
 Ensured that a clobbered condition code register is reflected in
 the clobbered register list for each asm() statement.
 This should FIX bug #147013.

2004-09-03  Sven Neumann  <sven@gimp.org>

 * libgimpbase/Makefile.am
 * libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades().

 * app/base/temp-buf.c
 * app/display/gimpdisplayshell-render.c
 * libgimpwidgets/gimppreviewarea.c: use the new function instead
 of replicating these numbers in three different places.

2004-09-03  DindinX  <david@dindinx.org>

 * plug-ins/gimpressionist/*.c: made the code much more readable by
 applying the gimp's coding standard (intentation, space, etc.), and
 remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use
 any deprecated stuff anymore.

2004-09-02  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimp/gimpui.def
 * libgimpbase/gimpbase.def
 * libgimpwidgets/gimpwidgets.def: added the preview and progress
 related entries

2004-09-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/neon.c
 * plug-ins/common/noisify.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/unsharp.c: fixed various coding style and naming
 issues and added some missing signal connections to update the new
 previews.

2004-09-02  DindinX  <david@dindinx.org>

 * plug-ins/common/despeckle.c: don't assume the preview has always the
 same size, and do the memory allocation in preview_update(). As a side
 effect, this fix a segfault :-).  Also save the preview toggle state
 between invocations.

2004-09-02  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplayshell-render.c (check_combos): light and
 dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.

 * libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and
 "check-type" properties and draw the checkerboard accordingly.

2004-09-02  Sven Neumann  <sven@gimp.org>

 * app/base/base-enums.[ch]
 * libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and
 GimpCheckType enums to libgimpbase. Correctly prefix the enum
 values.

 * app/base/temp-buf.c
 * app/config/gimpdisplayconfig.c
 * app/display/gimpdisplayshell-render.c
 * app/pdb/fileops_cmds.c
 * tools/pdbgen/pdb/fileops.pdb: changed accordingly.

2004-09-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-interface.c (script_fu_ok)
 * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
 use a GString for assembling the commands string instead of
 g_sprintf()ing into a buffer. Removes the need for a separate loop
 over all args to determine the buffer's length and makes the
 remaining code smaller and more readable.

2004-09-02  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public,
 added some gtk-doc comments.
 (gimp_preview_toggle_callback): immidiately invalidate the preview.

 * plug-ins/common/gauss.c (gauss): fixed (and simplified) handling
 of zero radii by using the new GimpPreview API.

2004-09-01  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-mmx.[ch]: Added
 gimp_composite_addition_va8_va8_va8_mmx().

 * app/composite/make-installer.py: Regression tests now include
 printing the image type for each test.

 * app/composite/gimp-composite-mmx-test.c
 * app/composite/gimp-composite-regression.c
 * app/composite/gimp-composite-sse-test.c
 * app/composite/gimp-composite-sse2-test.c
 * app/composite/gimp-composite-x86.h: regenerated.

2004-09-02  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/borderaverage.c
 * plug-ins/common/checkerboard.c
 * plug-ins/common/diffraction.c
 * plug-ins/common/illusion.c
 * plug-ins/common/polar.c
 * plug-ins/common/ripple.c
 * plug-ins/common/spread.c
 * plug-ins/common/video.c: don't pass run_mode to
 gimp_rgn_iterator_new(), it's unused. Removes the need for it being
 a global variable.

2004-09-01  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplay.c
 * app/widgets/gimpprogressdialog.c: gracefully handle progress
 calls after the widget is destroyed. Re-fixes bug #150194.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.[ch]
 * libgimpwidgets/gimppreview.[ch]: always show the "Preview" check
 button. Simplified the preview APIs, moved the "size" style
 property to the GimpPreview class.

 * etc/gtkrc: changed the example accordingly.

 * plug-ins/common/despeckle.c
 * plug-ins/common/gauss.c
 * plug-ins/common/neon.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API.

2004-09-01  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-types.h (struct SFOption): changed
 "guint history" to "gint history".

 * plug-ins/script-fu/script-fu-interface.c: added callbacks for
 string entries and combo boxes and connect *all* widgets to callbacks.

 (script_fu_ok): don't touch the widgets at all but get the values
 directly now that the callbacks correctly write them to their
 structs.

 (script_fu_reset): don't copy the default values manually but
 simply set the default values on the widgets; their callbacks will
 do the rest.

 * plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script):
 added some line breaks and spaces to make it more readable.

2004-09-01  Michael Natterer  <mitch@gimp.org>

 * libgimp/Makefile.am
 * libgimp/gimpui.h
 * libgimp/gimpuitypes.h
 * libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which
 automatically redirects any progress calls to itself while
 it exists.

 * plug-ins/script-fu/script-fu-interface.c: removed all progress
 callbacks and simply use a GimpProgressBar.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]: set a busy cursor while the
 preview is being recalculated.

 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original):
 do nothing if there's no drawable.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x
 and y variables.

 * libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup.

2004-09-01  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/gimpfu.py
 * plug-ins/pygimp/gimpmodule.c: Hacked up support for the new
 progress interface. Emphasis on hacked.

 * plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor
 cleanups.

 * plug-ins/pygimp/pygimp-image.c
 * plug-ins/pygimp/pygimp-tile.c: Minor cleanups.

2004-08-31  Manish Singh  <yosh@gimp.org>

 * plug-ins/pygimp/plug-ins/gimpcons.py
 * plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop
 calls.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c: increased default preview size to
 150 pixels. Added a border of 2 pixels around the bounding box of
 the selection.

 * libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor
 if there's something to pan. Set the correct page size on the
 scrollbar adjustments.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.[ch]: added new function
 gimp_preview_area_set_offsets().

 * libgimpwidgets/gimppreview.c: use the new function to let the
 checkerboard scroll with the preview.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.[ch]: delay the emission of the
 "invalidated" signal using a timeout. Removed hack that used to
 invalidate the preview on button-release.

 * plug-ins/common/unsharp.c: no need to fiddle with the slider
 update policies any longer.

2004-09-01  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
 gimp_dialog_factory_dialog_new() to let the caller decide whether
 the window should be presented or not.

 * app/actions/dialogs-commands.c
 * app/actions/image-commands.c
 * app/actions/templates-commands.c
 * app/gui/gui-vtable.c
 * app/gui/gui.c
 * app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
 gimp_dialog_factory_dialog_new() present the dialog if we need to
 change it after creation. This avoids annoying resizes, noticeable
 especially with the error dialog.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpdockable.c
 * libgimp/gimpdrawablepreview.c: converted tabs to spaces.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.c: added a style property for the
 minimum size.

 * etc/gtkrc: show how to adjust the size of GimpDrawablePreviews.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdatafactoryview.c
 (gimp_data_factory_view_activate_item): emit "clicked" on the
 edit_button only if it exists and is sensitive. Fixes bug #151343.

2004-08-31  Manish Singh  <yosh@gimp.org>

 * app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message
 to GSourceFunc.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c: handle the widget size dynamically.
 Hide scrollbars when there's nothing to scroll.

 * libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars
 are handled completely in the GimpPreview widget now.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c: removed the hardcoded preview size,
 removed some redundant assertions.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code...
 Also did some minor cleanups.

 * plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here.

 * plug-ins/script-fu/script-fu-types.h: new file keeping the
 various struct defs needed by both the above files.

 * plug-ins/script-fu/Makefile.am
 * plug-ins/script-fu/siod-wrapper.c: changed accordingly.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
 notify the "update" property on the preview, not the toggle.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreview.c: allow to pan the preview with all
 mouse buttons. Set a cursor to indicate that panning is possible.

2004-08-31  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreview.c
 * libgimpwidgets/gimppreview.h: renamed the "updated" signal to
 "invalidated" and the confusing "update" virtual function to "draw".

 Gave the properties saner names, too.

 Removed _get_width and _get_height functions in favor of a _get_size
 one.

 Added gimp_preview_invalidate function that emits the "invalidated"
 signal if needed.

 * libgimp/gimpdrawablepreview.c
 * libgimp/gimpdrawablepreview.h: modified accordingly and fixed the
 scrollbar range.

 * plug-ins/common/despeckle.c
 * plug-ins/common/gauss.c
 * plug-ins/common/neon.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/unsharp.c: modified accordingly.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c: removed the script title
 label and moved the "About" button to the action_area. Minor
 cleanups.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-transform.[ch]: added GimpProgress
 parameter to gimp_drawable_transform_affine().

 * tools/pdbgen/pdb/edit.pdb
 * tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend"
 and all transform functions.

 * app/pdb/edit_cmds.c
 * app/pdb/transform_tools_cmds.c: regenerated.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW
 to restore the default cursor, simply pass NULL to
 gdk_window_set_cursor().

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info"
 member and construct property. Changed gimp_paint_options_new()
 to take only a GimpPaintInfo parameter.

 * app/core/gimpitem.c (gimp_item_stroke)
 * app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly.

 * app/core/gimpchannel.c (gimp_channel_stroke)
 * app/vectors/gimpvectors.c (gimp_vectors_stroke): use
 paint_options->paint_info->paint_type directly instead of casting
 to GimpToolOptions and using
 tool_options->tool_info->paint_info->paint_type (eek). Fixes crash
 when stroking via the PDB because newly created GimpToolOptions
 instances have no "tool_info" pointer yet.

 * tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers
 accordingly.

 * app/pdb/paint_tools_cmds.c: regenerated.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * app/config/gimpconfig.c (gimp_config_iface_duplicate): set
 construct_param->foo, not construct_param*s*->foo, so we don't set
 the first construct param again and crash.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/cubism.c: added "..." to the progress text.

2004-08-31  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-actions.c (file_actions): added "..." to "Revert".

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpuitypes.h
 * libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview
 typedef to the header file that it belongs to.

 * libgimp/gimpdrawablepreview.[ch]: minor include cleanups and
 gtk-doc fixes.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/gauss.c (gauss_dialog): update the preview when
 the blur radius is being changed. gimp_coordinates_new() seems to
 be broken though; there shouldn't be two signal connections needed
 here.

2004-08-31  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawablepreview.[ch]
 * libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to
 gtk-doc comments and to the handling of object properties.

2004-08-31  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreview.c
 * libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract
 base for a GimpDrawablePreview.

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgets.h
 * libgimpwidgets/gimpwidgetstypes.h: modified accordingly.

 * libgimp/gimpdrawablepreview.c
 * libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget
 to ease the use of previews by plug-ins.

 * libgimp/Makefile.am
 * libgimp/gimpui.h: Changed accordingly.

 * plug-ins/common/despeckle.c
 * plug-ins/common/gauss.c
 * plug-ins/common/neon.c
 * plug-ins/common/sobel.c
 * plug-ins/common/softglow.c
 * plug-ins/common/spread.c
 * plug-ins/common/unsharp.c: use a GimpDrawablePreview with these
 plug-ins.

2004-08-30  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-progress.[ch]: added boolean return values
 to plug_in_progress_install(), uninstall() and cancel(). Added
 checks to make sure the installed progress_callback exists, has
 the correct signature and was installed by this plug-in.

 * tools/pdbgen/pdb/progress.pdb: use the return values to let the
 PDB wrappers succeed/fail.

 * app/pdb/progress_cmds.c: regenerated.

2004-08-30  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimp/gimp.def: added gimp_progress_install &
 gimp_progress_uninstall

2004-08-30  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpregioniterator.c: document the fact that "run_mode"
 is unused. Also did some code cleanup.

2004-08-30  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpregioniterator.c: always update the progress.
 Makes all "run_mode" parameters useless.

2004-08-30  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/gauss.c: add "..." to the progress text.

2004-08-30  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpprogress.c: added some gtk-doc comments, could be
 improved further.

2004-08-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/colortoalpha.c
 * plug-ins/common/compose.c
 * plug-ins/common/decompose.c
 * plug-ins/common/film.c
 * plug-ins/fits/fits.c: always use the progress API, not doing it
 in non-interactive mode has always been wrong.

2004-08-30  Manish Singh  <yosh@gimp.org>

 * libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the
 user_data pointer on uninstall. Eases language binding work.

2004-08-30  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
 drawing of brushes that extend beyond the preview.

2004-08-30  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
 avoid excessive use of strdup() and strcmp(). The strings are all
 constant anyway.

2004-08-30  Michael Natterer  <mitch@gimp.org>

 Brought the PDB progress into a working state. Fixes bug #6010,
 addresses bugs #97266 and #135185 and unfortunately reopens bug
 #150194 (will fix that later).

 * libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.

 * app/core/gimppdbprogress.c
 * libgimp/gimpprogress.c: use the enum instead of integer
 constants for the different progress commands. Cleanup.

 * app/plug-in/plug-in-progress.c
 * app/plug-in/plug-in-run.c
 * app/plug-in/plug-in.c: switch back to real refcounting for
 plug_in->progress (reopens bug #150194) and enabled the PDB
 progress code.

 * plug-ins/script-fu/script-fu-scripts.c: cleaned up the
 progress stuff and the script-fu interface a bit.

 * plug-ins/pygimp/gimpenums.py
 * plug-ins/script-fu/script-fu-constants.c
 * tools/pdbgen/enums.pl: regenerated.

2004-08-29  Manish Singh  <yosh@gimp.org>

 * app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
 recv_message watch, so we don't block on recursive calls to the
 handler. plug_in_recv_message needs some refcounting help now
 though.

2004-08-29  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-x86.h
 * app/composite/gimp-composite-sse.c
 * app/composite/gimp-composite-sse2.c: Fixed a bunch of
 warnings due to bad type casting.

 * app/composite/gimp-composite-mmx.c
 * app/composite/gimp-composite-sse.c
 * app/composite/gimp-composite-x86.h
 * app/composite/gimp-composite-sse2.c:
 The last changes to fix the the clobber registers bug #147013.
 Commented out some dead code to be reviewed later.

2004-08-29  Michael Natterer  <mitch@gimp.org>

 Added an API to allow plug-ins to embed the progress for the
 actions they trigger into their own GUI (attention: half-done and
 broken code ahead...)

 * app/core/Makefile.am
 * app/core/core-types.h
 * app/core/gimppdbprogress.[ch]: new object implementing dispatching
 progress calls to a temporary PDB procedure in a plug-in.

 * app/Makefile.am: force to link gimppdbprogress.o, bah!

 * app/plug-in/plug-in-progress.[ch]: added API to install,
 uninstall and cancel a PDB progress for this plug-in, but disabled
 the implementation because it doesn't work yet.

 * tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
 install, uninstall and cancel functions.

 * libgimp/Makefile.am
 * libgimp/gimp.h
 * libgimp/gimpprogress.[ch]: added an API around the PDB progress
 stuff.

 * app/pdb/internal_procs.c
 * app/pdb/progress_cmds.c
 * libgimp/gimpprogress_pdb.[ch]: regenerated.

 * plug-ins/script-fu/script-fu-scripts.c: use the new API to show
 the progress in the script-fu dialog.

2004-08-29  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimpwidgets/gimpwidgets.def: added
 gimp_scale_entry_set_logarithmic

2004-08-29  Sven Neumann  <sven@gimp.org>

 * app/config/gimpconfigwriter.c: don't emit critical warnings
 about a messed up state of GimpConfigWriter if the writer is
 disabled because of a write error that occured earlier.

2004-08-29  DindinX  <david@dindinx.org>

 * app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

 * app/core/core-enums.c: Regenerated.

 * app/actions/dockable-actions.c

 * app/config/gimpcoreconfig.c
 * app/config/gimpcoreconfig.h
 * app/config/gimpdisplayconfig.c
 * app/config/gimpdisplayconfig.h

 * app/core/gimpundo.c

 * app/display/gimpnavigationeditor.c

 * app/gui/dialogs.c
 * app/gui/file-open-location-dialog.c

 * app/tools/gimppaintoptions-gui.c
 * app/tools/gimptextoptions.c

 * app/widgets/gimpbrushselect.c
 * app/widgets/gimpcontainerpopup.c
 * app/widgets/gimpcontainerview.c
 * app/widgets/gimpdialogfactory.c
 * app/widgets/gimpfontselect.c
 * app/widgets/gimpgradientselect.c
 * app/widgets/gimppaletteselect.c
 * app/widgets/gimppatternselect.c
 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimpsessioninfo.c
 * app/widgets/gimptemplateeditor.c
 * app/widgets/gimpundoeditor.c
 * app/widgets/gimpundoeditor.h
 * app/widgets/gimpviewablebutton.c: Changed accordingly.

2004-08-28  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-sse.c
 * app/composite/gimp-composite-sse2.c: More updates to accomodate
 the clobber registers. Additional progress against bug #147013.

 * app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
 manifest constant definition caused sse2 instructions to never be
 compiled.

2004-08-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/vpropagate.c (run): fixed confusion about which
 mode to use when being run with last values (bug #151308).

2004-08-28  Simon Budig  <simon@gimp.org>

 * plug-ins/common/plugindetails.c: workaround to avoid a warning
 by gcc about the use of "%c" in the format string for strftime.

2004-08-28  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
 S. O. Bueno which adds an API that allows to make the scale widget
 of a GimpScaleEntry behave logarithmic. Fixes bug #149420.

 * app/widgets/gimpbrusheditor.c: use the new functionality for the
 radius control.

2004-08-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/compose.c (compose_dialog): applied patch from
 Markus Triska that improves which layers are choosen by
 default (bug #148172).

2004-08-28  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimage-contiguous-region.c
 (find_contiguous_region_helper): applied a patch from Eric Cheung
 that changes the function to use a GQueue to implement recursion
 instead of recursive function calls. Fixes bug #151124.

 * plug-ins/common/noisify.c (noisify_dialog): left-align the
 preview.

2004-08-28  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp-ids.h
 * app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
 help-id for the image area.

2004-08-27  Michael Natterer  <mitch@gimp.org>

 Moved the gimp_progress_init() and gimp_progress_update() PDB
 functions to their own group because they don't belong to the
 "Plug-In" namespace and will soon get more functions.

 * tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...

 * tools/pdbgen/pdb/progress.pdb: ...and added it here.

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/groups.pl
 * app/pdb/Makefile.am
 * libgimp/Makefile.am: changed accordingly.

 * app/pdb/progress_cmds.c
 * libgimp/gimpprogress_pdb.[ch]: new generated files.

 * app/pdb/internal_procs.c
 * app/pdb/plug_in_cmds.c
 * libgimp/gimp_pdb.h
 * libgimp/gimpplugin_pdb.[ch]: regenerated.

2004-08-27  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainereditor.c
 (gimp_container_editor_construct): call
 gimp_container_editor_select_item() manually at construction time
 so views show the initially selected object's state correctly
 (e.g. the brush spacing). Fixes bug #151227.

2004-08-27  DindinX  <david@dindinx.org>

 * app/widgets/gimpnavigationpreview.c
 * app/widgets/gimpnavigationpreview.h: renamed these files to ...

 * app/widgets/gimpnavigationview.c
 * app/widgets/gimpnavigationview.h: to these.
 And renamed the GimpNavigationPreview type to GimpNavigationView.

 Hopefully, this is the last change in file names for the Preview->View
 renaming process.

 * app/display/gimpnavigationeditor.c

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h: Changed accordingly.

2004-08-26  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpitem.[ch]: removed "gboolean use_default_values"
 from GimpItem::stroke().

 * app/core/gimpchannel.c
 * app/core/gimpselection.c
 * app/vectors/gimpvectors.c: changed accordingly.

2004-08-26  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpitem.c (gimp_item_stroke): implement the whole
 paint_options fiddling here instead of in each subclass and pass
 either GimpStrokeOptions or GimpPaintOptions (instead of
 GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().

 Also copied code (that needs to be abstracted to a utility
 function) from the tool_manager which makes sure we really use the
 global brush, pattern etc. if these options are checked in prefs.
 Fixes bug #150716.

 * app/core/gimpchannel.c (gimp_channel_stroke)
 * app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
 duplicated code mentioned above and simply use the paint_options
 passed.

2004-08-26  DindinX  <david@dindinx.org>

 * app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
 really derived from GimpViewRenderer and not from
 GimpViewRendererDrawable.

2004-08-26  DindinX  <david@dindinx.org>

 * app/widgets/gimppreviewrenderer-utils.c
 * app/widgets/gimppreviewrenderer-utils.h
 * app/widgets/gimppreviewrendererbrush.c
 * app/widgets/gimppreviewrendererbrush.h
 * app/widgets/gimppreviewrendererdrawable.c
 * app/widgets/gimppreviewrendererdrawable.h
 * app/widgets/gimppreviewrenderergradient.c
 * app/widgets/gimppreviewrenderergradient.h
 * app/widgets/gimppreviewrendererimage.c
 * app/widgets/gimppreviewrendererimage.h
 * app/widgets/gimppreviewrendererimagefile.c
 * app/widgets/gimppreviewrendererimagefile.h
 * app/widgets/gimppreviewrendererlayer.c
 * app/widgets/gimppreviewrendererlayer.h
 * app/widgets/gimppreviewrenderervectors.c
 * app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

 * app/widgets/gimpviewrenderer-utils.c
 * app/widgets/gimpviewrenderer-utils.h
 * app/widgets/gimpviewrendererbrush.c
 * app/widgets/gimpviewrendererbrush.h
 * app/widgets/gimpviewrendererdrawable.c
 * app/widgets/gimpviewrendererdrawable.h
 * app/widgets/gimpviewrenderergradient.c
 * app/widgets/gimpviewrenderergradient.h
 * app/widgets/gimpviewrendererimage.c
 * app/widgets/gimpviewrendererimage.h
 * app/widgets/gimpviewrendererimagefile.c
 * app/widgets/gimpviewrendererimagefile.h
 * app/widgets/gimpviewrendererlayer.c
 * app/widgets/gimpviewrendererlayer.h
 * app/widgets/gimpviewrenderervectors.c
 * app/widgets/gimpviewrenderervectors.h: ... to these names. And also
 changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

 * app/tools/gimppaintoptions-gui.c

 * app/widgets/Makefile.am
 * app/widgets/gimpcomponenteditor.c
 * app/widgets/gimpfiledialog.c
 * app/widgets/gimpgradienteditor.c
 * app/widgets/gimpview.c
 * app/widgets/widgets-types.h
 * app/widgets/gimpviewrenderer.c
 * app/widgets/gimpviewrenderer.h: modified accordingly.

2004-08-26  Sven Neumann  <sven@gimp.org>

 * app/sanity.c (sanity_check_filename_encoding): try to convert
 the result of gimp_directory() to UTF-8 and bail out with a
 moderately helpful error message if this conversion fails. Works
 around bug #150917. Also marked these strings for translation.

2004-08-26  Sven Neumann  <sven@gimp.org>

 * app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
 as the default tool as suggested in bug #151091.

2004-08-26  DindinX  <david@dindinx.org>

 * app/widgets/gimppreview-popup.c
 * app/widgets/gimppreview-popup.h
 * app/widgets/gimppreviewrenderer.c
 * app/widgets/gimppreviewrenderer.h: really removed these files from
 cvs.

2004-08-25  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/gifload.c: Guard against bogus logical screen
 dimensions. Fixes bug #151053.

2004-08-26  DindinX  <david@dindinx.org>

 * app/widgets/gimppreview-popup.c
 * app/widgets/gimppreview-popup.h: renamed these files...

 * app/widgets/gimpview-popup.c
 * app/widgets/gimpview-popup.h: .. to these files, and changed the
 GimpPreviewPopup type to GimpViewPopup.

 * app/widgets/gimppreviewrenderer.c
 * app/widgets/gimppreviewrenderer.h: renamed these files...

 * app/widgets/gimpviewrenderer.c
 * app/widgets/gimpviewrenderer.h: .. to these files, and changed
 GimpPreviewRenderer to GimpViewRenderer.

 This is the second step of the great Preview->View renaming process.

 * app/display/gimpdisplayshell-layer-select.c
 * app/display/gimpnavigationeditor.c

 * app/widgets/Makefile.am
 * app/widgets/gimpbrushfactoryview.c
 * app/widgets/gimpbufferview.c
 * app/widgets/gimpcellrendererviewable.c
 * app/widgets/gimpcellrendererviewable.h
 * app/widgets/gimpcomponenteditor.c
 * app/widgets/gimpcontainerbox.c
 * app/widgets/gimpcontainercombobox.c
 * app/widgets/gimpcontainereditor.c
 * app/widgets/gimpcontainerentry.c
 * app/widgets/gimpcontainergridview.c
 * app/widgets/gimpcontainerpopup.c
 * app/widgets/gimpcontainertreeview-dnd.c
 * app/widgets/gimpcontainertreeview.c
 * app/widgets/gimpcontainerview.c
 * app/widgets/gimpdatafactoryview.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimpnavigationpreview.c
 * app/widgets/gimppatternfactoryview.c
 * app/widgets/gimppreviewrenderer-utils.c
 * app/widgets/gimppreviewrendererbrush.c
 * app/widgets/gimppreviewrendererbrush.h
 * app/widgets/gimppreviewrendererdrawable.c
 * app/widgets/gimppreviewrendererdrawable.h
 * app/widgets/gimppreviewrenderergradient.c
 * app/widgets/gimppreviewrenderergradient.h
 * app/widgets/gimppreviewrendererimage.c
 * app/widgets/gimppreviewrendererimage.h
 * app/widgets/gimppreviewrendererimagefile.c
 * app/widgets/gimppreviewrendererimagefile.h
 * app/widgets/gimppreviewrendererlayer.c
 * app/widgets/gimppreviewrenderervectors.c
 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimptemplateview.c
 * app/widgets/gimptooloptionseditor.c
 * app/widgets/gimptoolview.c
 * app/widgets/gimpview.c
 * app/widgets/gimpview.h
 * app/widgets/gimpviewablebutton.c
 * app/widgets/widgets-enums.h
 * app/widgets/widgets-types.h: Modified accordingly.

2004-08-25  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
 adding message boxes and redirect messages to stderr if there are
 too many messages.

2004-08-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * devel-docs/ggr.txt: fix incorrect statement, add note re SVG.

2004-08-25  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
 GimpMessageBox for each message added. Fixes bug #92604.

 * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
 functionality.

 * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

 * app/gui/dialogs-constructors.[ch]
 * app/gui/dialogs.c: manage GimpErrorDialog as singleton.

 * app/gui/gui-vtable.c (gui_message): use the new error dialog.

 * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
 domain.

 * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
 when being called with a NULL domain.

2004-08-25  DindinX  <david@dindinx.org>

 * app/display/gimpnavigationeditor.[ch]: eradicate some more previews
 in favor of views.

2004-08-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * devel-docs/Makefile.am
 * devel-docs/ggr.txt: added new file decribing the ggr (Gimp
 gradient) file format.

2004-08-25  DindinX  <david@dindinx.org>

 * app/display/gimpnavigationview.c
 * app/display/gimpnavigationview.h: renamed these files to...

 * app/display/gimpnavigationeditor.c
 * app/display/gimpnavigationeditor.h: ... these files, and of course
 changed GimpNavigationView to GimpNavigationEditor since it is really
 inherited from GimpEditor anyway.

 This will leave the gimp_navigation_view namespace for the renaming
 from gimp_navigation_preview.

 * app/display/Makefile.am
 * app/display/display-types.h
 * app/display/gimpdisplayshell-callbacks.c
 * app/gui/dialogs-constructors.c: Changed accordlingly.

2004-08-25  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-title.c
 (gimp_display_shell_format_title): print bad '%' sequences
 literally instead of warning (g_warning() is for programming
 errors only and must never be triggered by bad or intermediate
 user input). Fixes bug #150676

2004-08-24  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpmessagebox.c: put the icon to the right for RTL
 layouts.

 * app/display/gimpdisplayshell-close.c
 * app/gui/quit-dialog.c: use a GimpMessageBox.

2004-08-24  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpmessagebox.[ch]: added API to change the labels.
 Modeled after the proposed new API for GtkMessageDialog.

 * app/widgets/gimpwidgets-utils.c: changed accordingly.

2004-08-24  DindinX  <david@dindinx.org>

 * app/widgets/gimppreview.c
 * app/widgets/gimppreview.h: renamed these two files to...

 * app/widgets/gimpview.c
 * app/widgets/gimpview.h: ... these files.

 Also renamed GimpPreview to GimpView.
 This is the first step of the great Preview->View renaming process.

 * app/actions/palettes-commands.c

 * app/display/gimpdisplayshell-layer-select.c
 * app/display/gimpnavigationview.c

 * app/gui/palette-import-dialog.c

 * app/tools/gimppaintoptions-gui.c

 * app/widgets/Makefile.am
 * app/widgets/gimpaction.c
 * app/widgets/gimpactiongroup.c
 * app/widgets/gimpbrusheditor.c
 * app/widgets/gimpbufferview.c
 * app/widgets/gimpcontainerbox.c
 * app/widgets/gimpcontainergridview.c
 * app/widgets/gimpcontainergridview.h
 * app/widgets/gimpdevicestatus.c
 * app/widgets/gimpdnd.c
 * app/widgets/gimpdockbook.c
 * app/widgets/gimpfiledialog.c
 * app/widgets/gimpgradienteditor.c
 * app/widgets/gimpnavigationpreview.c
 * app/widgets/gimpnavigationpreview.h
 * app/widgets/gimppaletteeditor.c
 * app/widgets/gimppreview-popup.c
 * app/widgets/gimppropwidgets.c
 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimpthumbbox.c
 * app/widgets/gimptoolbox-image-area.c
 * app/widgets/gimptoolbox-indicator-area.c
 * app/widgets/gimptooloptionseditor.c
 * app/widgets/gimpviewabledialog.c
 * app/widgets/widgets-types.h: changed accordingly.

2004-08-24  Sven Neumann  <sven@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

 * app/widgets/gimpwidgets-utils.c: use it for message dialogs.

2004-08-23  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
 the filename if gtk_file_chooser_set_uri() failed.

 * app/actions/file-commands.c
 * app/gui/file-save-dialog.c: trivial cleanups.

 * app/widgets/gimpwidgets-utils.c: removed an unused extern
 variable declaration.

2004-08-23  DindinX  <david@dindinx.org>

 * app/tools/tools-utils.c: fixed a typo that broke the build.

2004-08-22  Sven Neumann  <sven@gimp.org>

 * app/tools/Makefile.am
 * app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

 * app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

 * app/tools/gimppainttool.c: changed accordingly.

 * app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
 instead of duplicating that functionality.

 * app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
 instead of implementing completely different constraints.

2004-08-22  Simon Budig  <simon@gimp.org>

 * app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
 shape differently to avoid possible rounding issues with
 the _arcto () command.

 * app/vectors/gimpvectors-import.c: properly close the rounded
 rectangles.

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpvectors-import.c (parse_svg_transform): support
 optional center coordinates for the "rotate" transformations.
 (parse_svg_transform): apply transformations in reverse order. The
 SVG spec is rather confusing here.

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
 a bug I introduced with my last commit.

 * app/vectors/gimpvectors-import.c: added support for the basic
 SVG shape "rect". Fixed handling of SVG lengths in basic shapes.

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpbezierstroke.[ch]: added new function
 gimp_bezier_stroke_new_ellipse() that provides a simple API to
 create a bezier stroke that represents an ellipse.

 * app/vectors/gimpvectors-import.c: added support for the basic
 SVG shapes "circle" and "ellipse".

2004-08-21  Simon Budig  <simon@gimp.org>

 * plug-ins/common/gih.c: Fix some GUI issues. Make the relation
 between the dimension parameter and the rank thingies more clear
 also changed to a nicer layout.

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpvectors-import.c: added support for the basic
 SVG shapes "polyline" and "polygon".

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpvectors-import.c: added support for importing
 the basic SVG shape "line". Other shapes will follow...

2004-08-21  Sven Neumann  <sven@gimp.org>

 * app/actions/layers-actions.[ch]
 * app/actions/layers-commands.[ch]
 * app/widgets/gimplayertreeview.c: added actions to handle layer
 masks as suggested in bug #150446.

 * menus/layers-menu.xml: added menu entries for new actions,
 commented out raise/lower menu entries.

2004-08-20  Sven Neumann  <sven@gimp.org>

 * modules/controller_linux_input.c: declare local function as static.

2004-08-19  Michael Schumacher <schumaml@cvs.gnome.org>

 * plug-ins/common/guillotine.c: modified the coordinate insertion
 into the file name to leave the file extension intact, changed the
 format of the coordinates. Fixes bug #101901.

2004-08-18  Manish Singh  <yosh@gimp.org>

 * app/widgets/gimpcellrendereraccel.c
 * app/widgets/gimphistogrambox.c
 * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.

2004-08-18  Sven Neumann  <sven@gimp.org>

 * app/gui/color-notebook.c: no need to set a size_request here.

 * libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

 * libgimpwidgets/gimpcolorscales.c
 * modules/colorsel_cmyk.c: don't set a minimum width on the color
 scales. Improves behaviour for narrow color dockables.

2004-08-18  Sven Neumann  <sven@gimp.org>

 * modules/colorsel_triangle.c: fixed crashes that occured with
 small sizes, some code cleanups and a simple optimization.

2004-08-18  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

 * app/widgets/gimpdock.c
 * app/widgets/gimpdockable.c: help-ids are never used directly,
 use the defines from app/widgets/gimphelp-ids.h instead.

2004-08-17  Simon Budig  <simon@gimp.org>

 * modules/colorsel_triangle.c: Made the triangle colorselector
 resizeable. Removed minimum size request (would probably need some
 testing for *very* small sizes though).

2004-08-17  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/widgets/gimpdock.c
 * app/widgets/gimpdockable.c: add help-ids.

2004-08-17  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
 the "cancel" signal handler id when a new progress is set.

2004-08-17  Sven Neumann  <sven@gimp.org>

 * modules/colorsel_cmyk.c: minor cleanups.

 * modules/colorsel_water.c: let the widget take the available
 space, don't set a minimum size.

2004-08-17  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-in-progress.c
 * app/plug-in/plug-in-run.c
 * app/plug-in/plug-in.c: don't keep a strong reference to the
 GimpProgress object, instead use a weak reference and deal with
 the progress being destroyed while the plug-in is running.
 Fixes bug #150194.

2004-08-16  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
 labels in CMYK mode. Fixes bug #150213.

2004-08-16  DindinX  <david@dindinx.org>

 * plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
 redrawn correctly in some case. Reported by AndyFitz.

2004-08-15  Sven Neumann  <sven@gimp.org>

 * modules/colorsel_triangle.c: minor cleanups.

 * modules/colorsel_water.c: GimpPreviewArea seems like overkill
 here, use a GtkDrawingArea instead.

2004-08-15  DindinX  <david@dindinx.org>

 * modules/colorsel_triangle.c
 * modules/colorsel_water.c: Replaced the GtkPreviews by
 GimpPreviewAreas.

2004-08-14  Manish Singh  <yosh@gimp.org>

 * libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
 length values are not negative, to prevent bad calls to g_new.
 Addresses bug #150154.

2004-08-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
 any GIMP libraries.

 * plug-ins/help/domain.[ch]: allow to specify the location of the
 index files independently from the base URL.

 * plug-ins/help/help.c: changed accordingly.

 * plug-ins/help/gimp-help-lookup.c: added command-line options to
 specify base URI and root directory for index files.

2004-08-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/help/locales.c (locales_parse): don't mess up the order
 of languages.

 * plug-ins/help/gimp-help-lookup.c: parse command-line options,
 added --help output.

2004-08-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/help/help.[ch]: moved some defines to the header file.

 * plug-ins/help/domain.c: trivial change to remove the libgimpbase
 dependency.

 * plug-ins/help/Makefile.am
 * plug-ins/help/gimp-help-lookup.c: added a very simple
 command-line tool that allows to lookup a help-id.

2004-08-13  DindinX  <david@dindinx.org>

 * plug-ins/common/edge.c: update the preview when the user choose a
 different algorithm from the combo box. This was one of the main
 reasons to have a preview here, after all.

2004-08-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/edge.c (edge_dialog): use a combo box instead of
 too many radio buttons.

2004-08-12  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
 make sure that all actions, even if they have no menu proxy, can
 be invoked by their accelerators. Fixes bug #149938.

 * app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
 removed the same code here.

 * app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
 function which disconnects from "accel_changed" of the accel_group
 before upchaining (== before emitting "destroy").

 The above changes make this one redundant, but since the crash in
 bug #149938 was triggered by "accel_changed" emitted in the middle
 of g_object_unref(tree_model), it feels better to be paranoic here
 (fiddling with objects in destruction is no fun).

 (gimp_action_view_accel_edited): don't warn if assigning the same
 accel to the same action again.

 (gimp_action_view_new): don't leak all accel_closures.

2004-08-12  DindinX  <david@dindinx.org>

 * plug-ins/common/edge.c: added a preview.

2004-08-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/sel_gauss.c
 * plug-ins/common/unsharp.c: place the preview widget into the
 upper left corner like all other plug-ins do.

 * plug-ins/help/domain.c: added some (disabled) debug output.

2004-08-12  DindinX  <david@dindinx.org>

 * plug-ins/common/sel_gauss.c: added a preview.

 * plug-ins/common/unsharp.c: removed unused variables.

2004-08-12  Sven Neumann  <sven@gimp.org>

 * app/actions/context-actions.c: changed the icons to indicate
 what part of the context is affected by the action. Looks better
 in the shortcut editor.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * plug-ins/common/cartoon.c
 * plug-ins/common/neon.c
 * plug-ins/common/photocopy.c
 * plug-ins/common/softglow.c: added four new plug-ins contributed
 by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.

 * plug-ins/common/plugin-defs.pl: added them here.

 * plug-ins/common/mkgen.pl: removed tab insanity now that
 libgimpoldpreview is gone.

 * plug-ins/common/.cvsignore
 * plug-ins/common/Makefile.am: regenerated.

2004-08-11  DindinX  <david@dindinx.org>

 Bad DindinX! Don't break the build!

 * configure.in
 * plug-ins/common/mkgen.pl
 * plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from
 here too.

 * plug-ins/common/Makefile.am: regenerated.

2004-08-11  DindinX  <david@dindinx.org>

 Removed the GimpOldPreview stuff. Die, crap, die!

 * plug-ins/libgimpoldpreview/*: removed.

 * plug-ins/Makefile.am
 * plug-ins/common/Makefile.am: changed accordingly.

 * plug-ins/common/max_rgb.c
 * plug-ins/common/noisify.c
 * plug-ins/common/tileit.c: removed last forgotten
 #include "libgimpoldpreview.h".

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainercombobox.[ch]
 * app/widgets/gimpcontainertreeview.c: when removing the last item
 from the view, manually clear all GimpCellRendererViewables'
 "renderer" properties; otherwise we have stale GimpPreviewRenderers
 with still-refed viewables hanging around in the cells.
 Works around GTK+ bug #149906.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp.c
 * app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
 changes.

2004-08-11  DindinX  <david@dindinx.org>

 * plug-ins/common/waves.c: GimpPreviewArea-ified.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 Restored sane sorting order for menus which are created
 entirely by plug-ins (like Xtns/Script-Fu/...).

 * app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
 return the built path. For each sub-menu created, add a "Menus"
 placeholder and a separator. Make sure all sub-menus end up in the
 "Menus" placeholder. More readable because we can use the path
 returned by the recursive invocation now.

 (plug_in_menus_add_proc): simplified by using the path
 plug_in_menus_build_path() returns.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpprogress.[ch]: added virtual function
 gboolean GimpProgressInterface::is_active().

 * app/display/gimpdisplay.c
 * app/display/gimpstatusbar.c
 * app/widgets/gimpfiledialog.c
 * app/widgets/gimpprogressbox.c
 * app/widgets/gimpprogressdialog.c
 * app/widgets/gimpthumbbox.c: implement it.

 * app/plug-in/plug-in.h: removed "gboolean progress_active" and
 added "gulong progress_cancel_id" instead.

 * app/plug-in/plug-in-progress.c: changed accordingly. Make sure
 we correctly handle the "cancel" connections of progress instances
 passed from other plug-ins.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-run.c (plug_in_temp_run)
 * libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
 #define and all code which was in #ifndef ENABLE_TEMP_RETURN.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().

 * app/gui/gui-vtable.c: changed accordingly.

 * app/plug-in/plug-in-progress.[ch]: reenabled showing the
 progress in a particular display.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * etc/controllerrc: added a commented-out midi controller entry
 with some example mappings.

2004-08-11  DindinX  <david@dindinx.org>

 * plug-ins/common/plasma.c: converted to GimpPreviewArea.

2004-08-11  DindinX  <david@dindinx.org>

 * plug-ins/common/noisify.c: converted to GimpPreviewArea.  Also added
 scrollbars to move around.  The preview was rather useless without
 them.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdrawable-blend.c
 * app/core/gimpprogress.c: some progress cleanup.

 * app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
 need to warn if there is already a progress active, just silently
 return NULL as all other GimpProgressInterface implementors.

 * app/plug-in/plug-in-progress.c: several progress fixes.
 It's still a mess.

 * plug-ins/common/url.c: don't show progress depending on
 run_mode. Run the actual file plug-in with the same run_mode we
 were invoked with.

2004-08-11  Sven Neumann  <sven@gimp.org>

 * app/gui/file-open-location-dialog.c
 * app/widgets/gimpprogressbox.c: increased horizontal size request
 to reduce resizing.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
 fixed annoying resizing when thumbnailing exactly one image.

2004-08-11  Michael Natterer  <mitch@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
 a label and a progressbar. Implements GimpProgressIterface.

 * app/widgets/gimpprogressdialog.[ch]: replaced label and progress
 by a GimpProgressBox. Delegate most progress functionality to it.

 * app/widgets/gimpwidgets-utils.[ch]: factored out utility
 function gimp_dialog_set_sensitive().

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
 use it.

 * app/gui/file-open-location-dialog.c (file_open_location_response):
 embed the called file procedure's progress using a GimpProgressBox.

2004-08-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpfiledialog.[ch]
 (gimp_file_dialog_set_sensitive): new function which works on all
 widgets in the dialog except the cancel button.

 Remember if the active progress is cancelable and added two
 booleans "busy" and "canceled". Added GtkDialog::response()
 implementation which, if the dialog is busy, cancels the active
 progress and sets the dialog's "canceled" state.

 Moved the progress bar right above the action area so it is next
 to the cancel button and in the same place for both open and save
 dialogs.

 * app/gui/file-open-dialog.c
 * app/gui/file-save-dialog.c: use the new API to make image loading
 and saving cancelable again.

 * app/widgets/gimpthumbbox.c: use the same stuff to make
 thumbnailing cancelable. Increased the minimum height a bit so it
 doesn't resize when the progress bars are shown.

2004-08-10  Michael Natterer  <mitch@gimp.org>

 Redid the whole internal progress stuff: don't pass around
 progress_callback and progress_data; instead, provide a
 pointer to a GimpProgressInterface which can be implemented
 by a variety of backends.

 Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

 * app/display/Makefile.am
 * app/display/gimpprogress.[ch]: removed the old progress hack.

 * app/core/Makefile.am
 * app/core/core-types.h
 * app/core/gimpprogress.[ch]: implement GimpProgressInterface.

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpprogressdialog.[ch]: the standalone progress
 dialog as widget implementing GimpProgressInterface.

 * app/display/gimpdisplay.c
 * app/display/gimpstatusbar.[ch]
 * app/widgets/gimpfiledialog.[ch]
 * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
 implementation to these classes.

 * app/core/gimp-gui.[ch]
 * app/gui/gui-vtable.c: replaced the old progress vtable entries
 by two new to create and destroy a GimpProgressDialog in case
 no other progress is available.

 * app/pdb/procedural_db.[ch]
 * app/plug-in/plug-in-run.[ch]
 * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
 all plug-ins.

 * app/plug-in/plug-in.[ch]
 * app/plug-in/plug-ins.c
 * app/plug-in/plug-in-message.c
 * app/plug-in/plug-in-progress.c: handle the case there the
 plug-in was crated with a progress as well as the case where it
 wasn't.

 * app/app_procs.c
 * app/batch.c
 * app/xcf/xcf.c
 * app/file/file-open.[ch]
 * app/file/file-save.[ch]
 * app/widgets/gimphelp.c
 * app/widgets/gimpbrushselect.c
 * app/widgets/gimpfontselect.c
 * app/widgets/gimpgradientselect.c
 * app/widgets/gimppaletteselect.c
 * app/widgets/gimppatternselect.c: changed accordingly.

 * app/core/gimpimagefile.[ch]
 * app/display/gimpdisplayshell-dnd.c
 * app/gui/file-open-dialog.c
 * app/gui/file-open-location-dialog.c
 * app/gui/file-save-dialog.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
 related functions. Embed the progress in the file dialog where
 possible.

 * app/core/gimpdrawable-blend.[ch]
 * app/core/gimpdrawable-transform.[ch]
 * app/core/gimpimage-convert.[ch]
 * app/core/gimpimage-flip.[ch]
 * app/core/gimpimage-resize.[ch]
 * app/core/gimpimage-rotate.[ch]
 * app/core/gimpimage-scale.[ch]
 * app/core/gimpitem-linked.[ch]
 * app/core/gimpitem.[ch]
 * app/core/gimpchannel.c
 * app/core/gimpdrawable.c
 * app/core/gimplayer.c
 * app/core/gimpselection.c
 * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

 * app/tools/gimpblendtool.c
 * app/tools/gimptransformtool.c
 * app/gui/convert-dialog.c
 * app/actions/documents-commands.c
 * app/actions/file-commands.c
 * app/actions/image-commands.c
 * app/actions/layers-commands.c
 * app/actions/plug-in-commands.c
 * app/actions/vectors-commands.c
 * tools/pdbgen/pdb/convert.pdb
 * tools/pdbgen/pdb/edit.pdb
 * tools/pdbgen/pdb/image.pdb
 * tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

 * app/pdb/*_cmds.c: regenerated.

2004-08-10  DindinX  <david@dindinx.org>

 * plug-ins/common/blinds.c: GimpPreviewArea-ified.

2004-08-10  DindinX  <david@dindinx.org>

 * plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
 for the color model instead of some defines and use gboolean instead
 of gint where appropriate.

2004-08-10  Sven Neumann  <sven@gimp.org>

 * app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
 plugged more file descriptor leaks.

2004-08-10  DindinX  <david@dindinx.org>

 * app/core/gimpbrushgenerated.c: don't leak a file descriptor when
 reading a bad .vbr file.

2004-08-10  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/unsharp.c: don't show progress on the image
 window while updating the preview.

2004-08-09  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/unsharp.c (unsharp_region): reset the progress
 when done; some code cleanup.

2004-08-09  DindinX  <david@dindinx.org>

 * plug-ins/common/unsharp.c: continuously show the (original) image
 during a scrollbar movement.  This makes it easier to navigate.

2004-08-09  Michael Natterer  <mitch@gimp.org>

 Applied (slightly modified) patch from Shlomi Fish which adds a
 progress bar to the RGB -> INDEXED conversion. Fixes bug #145274
 and shows that we really really need a GimpProgressInterface in
 the core to give progress users full access to the progress API.

 * app/core/gimpimage-convert.[ch]: added special
 GimpImageConvertProgress function typedef to cope with the
 different stages of converting.  Support passing such a callback &
 data to gimp_image_convert() and update the progress accordingly.

 * app/gui/convert-dialog.[ch]: added a convert progress callback
 and pass it to gimp_image_convert().

 * app/actions/image-commands.c
 * tools/pdbgen/pdb/convert.pdb: changed accordingly.

 * app/pdb/convert_cmds.c: regenerated.

2004-08-09  Sven Neumann  <sven@gimp.org>

 * data/misc/gimp.desktop.in.in: added GenericName and Version,
 updated Categories.

2004-08-09  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-ins.c
 (plug_ins_file_register_magic)
 (plug_ins_file_register_mime): don't dereference
 gimp->current_plug_in->plug_in_def if it's NULL.
 Fixes bug #149678.

 (plug_ins_file_register_mime): moved returning the proc_def inside
 the right if() statement.

2004-08-09  Hans Breuer  <hans@breuer.org>

 * app/core/gimp-edit.c (gimp_edit_paste_as_new):
 gimp_create_display() with the right parameters order

 * app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
 handle gtk_style_lookup_icon_set() returnig NULL

 * app/gimpcore.def app/widgets/makefile.msc
   themes/default/images/makefile.msc : updated

2004-08-09  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/postscript.c (save_ps_header): use the basename
 as Title, not the full filename. Fixes bug #149669.

2004-08-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
 character array, don't flush the buffer for each byte but wait
 until it is filled.

2004-08-08  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
 g_strdup_vprintf() instead of guessing the string length. Also
 declare the function using G_GNUC_PRINTF().

2004-08-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/ifscompose/README.ifscompose: fix out of date info,
 pointed out by the author.

2004-08-08  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/Makefile.am: do not build test-preview-area by
 default, put it into EXTRA_PROGRAMS. Fixes parallel builds.

2004-08-08  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
 new function which checks a GimpImageType against the
 proc_def->image_types_val mask.

 * app/actions/plug-in-actions.c: use the new function here. Also
 separated setting the "Repeat last" and "Reshow last" actions'
 labels from setting their sensitivity and made them use the same
 sensitivity logic as all other plug-in actions. Fixes bug #149567.

2004-08-07  Simon Budig  <simon@gimp.org>

 * libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
 when the hex entry is changed.

2004-08-07  Sven Neumann  <sven@gimp.org>

 * app/sanity.c: abort if the configured filename encoding can't be
 converted to UTF-8. Fixes bug #149464 for the HEAD branch.

2004-08-07  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
 corrected dither offset.

2004-08-07  DindinX  <david@dindinx.org>

 * plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of
 GimpOldPreview.

2004-08-07  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
 GtkPreview.

 * libgimp/gimpbrushmenu.c
 * libgimp/gimppatternmenu.c: minor cleanup.

2004-08-07  DindinX  <david@dindinx.org>

 * plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
 cleanup and removed tabs.

2004-08-07  Sven Neumann  <sven@gimp.org>

 * configure.in:  bumped version number to 2.1.4.

2004-08-07  DindinX  <david@dindinx.org>

 * plug-ins/common/illusion.c: ported to GimpPreviewArea.

2004-08-07  DindinX  <david@dindinx.org>

 * libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
 and INDEXEDA image types.

 * plug-ins/common/grid.c: ported to GimpPreviewArea.

2004-08-06  DindinX  <david@dindinx.org>

 * plug-ins/common/glasstile.c: ported to GimpPreviewArea.

2004-08-06  DindinX  <david@dindinx.org>

 * plug-ins/common/nlfilt.c: ported to GimpPreviewArea.

2004-08-06  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptransformtool.h: removed the recently added
 "gdouble aspect_ratio"...

 * app/tools/gimpscaletool.[ch]: ...and added it where it belongs.

2004-08-06  Michael Natterer  <mitch@gimp.org>

 Transform tool cleanup:

 * app/tools/gimptransformtool.[ch]: added new virtual function
 GimpTransformTool::dialog_update().
 Made wrapper for ::recalc() public and function
 transform_bounding_box() private.
 Call ::dialog_update() and transform_bounding_box() from the
 ::recalc() wrapper.

 * app/tools/gimpperspectivetool.[ch]
 * app/tools/gimprotatetool.[ch]
 * app/tools/gimpscaletool.[ch]
 * app/tools/gimpsheartool.[ch]: turned all info_dialog update
 functions into GimpTransformTool::dialog_update() implementations
 and don't call them from ::recalc(), also removed calls to
 transform_bounding_box(); both functions are called by the parent
 class now. Call gimp_transform_tool_recalc() when dialog values
 were changed, not the tool's internal function.
 Moved all static variables to the instance structs.

2004-08-06  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
 Pollak which enables controlling the shear direction from the
 dialog and changing the shear direction without hitting "Reset".
 Fixes bug #149467.

 Also moved all static variables to the GimpShearTool struct and
 converted tabs to spaces.

2004-08-06  DindinX  <david@dindinx.org>

 * plug-ins/common/nova.c: ported to GimpPreviewArea.

2004-08-06  Sven Neumann  <sven@gimp.org>

 * Made 2.1.3 release.

2004-08-06  DindinX  <david@dindinx.org>

 * plug-ins/common/polar.c: ported to GimpPreviewArea (from
 GimpOldPreview).

2004-08-06  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/test-color-parser.c: include <glib-object.h>.

2004-08-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/depthmerge.c:
 * plug-ins/common/despeckle.c: removed unused variables.

2004-08-06  DindinX  <david@dindinx.org>

 * plug-ins/common/flarefx.c: ported to GimpPreviewArea (from
 GimpOldPreview)

2004-08-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
 tw_sess.c here.

2004-08-05  DindinX  <david@dindinx.org>

 * plug-ins/common/wind.c: ported to GimpPreviewArea (from
 GimpOldPreview)

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpiscissorstool.c: increased the handle size from 8
 to 9 pixels (which is the same as in the path tool) as suggested
 in bug #134250.

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpstatusbar.c: make the cursor coordinates label
 insensitive when displaying out-of-image coordinates.

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
 s/pseudocolor visuals/8-bit (256 colors) displays/.
 Fixes bug #137078.

2004-08-05  Michael Natterer  <mitch@gimp.org>

 Enabled previewing items without selecting them in all list and
 grid views using mouse button 2. Implicitly enables previewing of
 items in container popups and thus fixes bug #121011:

 * app/widgets/gimppreview.c (gimp_preview_button_press_event)
 * app/widgets/gimpcellrendererviewable.c
 (gimp_cell_renderer_viewable_clicked): show the preview also on
 mouse button 2 click.

 * app/widgets/gimpcontainertreeview.c
 (gimp_container_tree_view_button_press): dispatch mouse button 2
 clicks to GimpCellRendererViewable, but don't select or change
 anything in the tree_view.

 Unrelated cleanup:

 * app/widgets/gimppreview.c (gimp_preview_button_press_event):
 don't offset bevent->x,y by widget->allocation.x,y before calling
 gimp_preview_popup_show() ...

 * app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
 ... instead, do it here generically (check if the parent widget is
 GTK_WIDGET_NO_WINDOW()).

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
 allocate the empty_iter using g_new0(). Fixes valgrind warnings
 about reads from uninitialized memory.

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
 all "Set" actions (like context-foreground-red-set).

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpscaletool.c
 * app/tools/gimptransformtool.h: applied patch from Jordi Gay
 (attached to bug #131111) which adds an aspect ratio spinbutton to
 the scale dialog and keeps the aspect ratio intact when width or
 height are changed using the dialog. Fixes bug #132274.

 * app/tools/gimpcroptool.c
 * app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
 "wrap" and decrease their climb_rate.

2004-08-05  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c
 * app/actions/context-commands.[ch]
 * menus/image-menu.xml.in: added actions, callbacks and menu items
 for the brush shape and spikes.

2004-08-04  Simon Budig  <simon@gimp.org>

 * plug-ins/common/grid.c: changed the default colors for the
 first invocation to the current foregroud color which is more
 likely to be useful than the blue shades.

2004-08-04  Sven Neumann  <sven@gimp.org>

 * themes/Default/images/Makefile.am
 * themes/Default/images/stock-brush-generated-*-16.png: removed ...

 * themes/Default/images/stock-shape-*-16.png: ... and added back
 with more generic names.

 * libgimpwidgets/gimpstock.[ch]
 * app/widgets/gimpbrusheditor.c: changed accordingly.

 * app/tools/gimpinkoptions-gui.c: use the new stock icons here as
 well.

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpblobeditor.[ch]: added a simple blob shape
 editor widget factored out of app/tools/gimpinkoptions-gui.c.

2004-08-04  Simon Budig  <simon@gimp.org>

 * app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
 parameter to make more soft brushes possible. Please note that this
 makes existing generated brushes look more soft. But since people
 apparently rarely use more than one or two generated brushes and
 these get changed frequently I guess it should be OK.

2004-08-04  Michael Natterer  <mitch@gimp.org>

 Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
 linked against GLib >= 2.4.5. Fixes bug #148140.

 * app/core/gimp-utils.[ch]: added gimp_check_glib_version().

 * app/widgets/gimpselectiondata.c: added runtime check for GLib
 versions that encode file:// URIs correctly (>= 2.4.5). For older
 (broken) GLibs, leave the code path as is, for newer (fixed) ones,
 perform an additional check if the dropped URI is in the (broken)
 escaped-UTF-8 format and convert it to local filename encoding.

 * app/gui/gui.c: warn the user that non-ASCII filenames can't
 be used when linked against GLib 2.4.4.

2004-08-04  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in"
 to "PlugInProcDef *last_plug_in". Added function
 gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.

 * app/actions/plug-in-commands.c
 * app/plug-in/plug-in-run.c: changed accordingly.

 * app/actions/plug-in-actions.c: factored out updating of the
 "Reshow Last" and "Rerun Last" actions to a private function.
 Connect each "plug-in" action group to Gimp::last-plug-in-changed
 and update the actions' label and sensitivity in the
 callback. Fixes bug #149139.

2004-08-04  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"

2004-08-04  Manish Singh  <yosh@gimp.org>

 * configure.in: Really really really really fix WINDRES logic.

2004-08-03  DindinX  <david@dindinx.org>

 * plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs
 work.

2004-08-03  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainergridview.c
 (gimp_container_grid_view_item_context): ref/unref the view around
 the calls to gimp_container_view_item_selected() and _item_context()
 because the former may destroy the view which leads to a crash
 when trying the latter. Fixes bug #148955.

2004-08-03  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
 new function which checks if undo compression is possible:

 (1) is the image dirty? Fixes bug #148853.
 (2) is redo stack empty?
 (3) do both the passed undo object_type and undo_type
     match the top undo item?

 Consistently name the GType and GimpUndoType passed to undo
 functions "object_type" and "undo_type" to avoid confusion.

 * app/actions/layers-commands.c
 * app/tools/gimpeditselectiontool.c
 * app/tools/gimptexttool.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimplayertreeview.c: use the new utility function
 instead of checking the above conditions manually.

2004-08-03  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
 leak the brush's name if parsing the shape fails.

 (gimp_brush_generated_dirty): shut up bogus compiler warnings
 about uninitialized variables.

2004-08-03  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/imagemap/imap_preview.c
 * plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.

2004-08-03  DindinX  <david@dindinx.org>

 * plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.

2004-08-03  DindinX  <david@dindinx.org>

 * plug-ins/fp/fp.c: converted to GimpPreviewArea.

2004-08-03  DindinX  <david@dindinx.org>

 * plug-ins/rcm/rcm_callback.c
 * plug-ins/rcm/rcm_dialog.c
 * plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.

2004-08-02  Simon Budig  <simon@gimp.org>

 * app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
 with >= 2 spikes. Spotted by Joao S. O. Bueno.

 Fixes bug #149099.

2004-08-02  DindinX  <david@dindinx.org>

 * plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.

2004-08-02  DindinX  <david@dindinx.org>

 * plug-ins/common/video.c: ported to GimpPreviewArea.

2004-08-02  DindinX  <david@dindinx.org>

 * plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
 preview, too.

2004-08-01  DindinX  <david@dindinx.org>

 * plug-ins/common/tileit.c: ported to GimpPreviewArea.

2004-08-01  DindinX  <david@dindinx.org>

 * plug-ins/common/sinus.c: ported to GimpPreviewArea.

2004-08-01  Manish Singh  <yosh@gimp.org>

 * configure.in: Really really really fix WINDRES logic.

2004-08-01  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/mkgen.pl: update install-% rule to match newer
 libtool commands.

 * plug-ins/common/Makefile.am: regenerated.

2004-08-01  Manish Singh  <yosh@gimp.org>

 * configure.in: Really really fix WINDRES logic.

2004-08-01  Manish Singh  <yosh@gimp.org>

 * configure.in: Really fix WINDRES logic.

2004-08-01  DindinX  <david@dindinx.org>

 * plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.

2004-08-01  Hans Breuer  <hans@breuer.org>

 * app/display/makefile.msc app/widgets/makefile.msc : build
 but *dont link* display-enums.obj, widget-enums.obj and
 gimpdisplayoptions.obj. They must be in the dll
 * app/makefile.msc : build gimp.exe and gimp-console.exe both
 using the same gimp-core.dll
 * app/gimpcore.def : new file, exports for gimp-core.dll
 * app/Makefile.am : added to EXTRA_DIST

 * cursors/makefile.msc : new file to create gimp-tool-cursors.h
 * cursors/Makefile.am : added to EXTRA_DIST

 * **/makefile.msc : updated

 * app/main.c app/app_procs.c : moved code to close the console
 from the former to the later. It only is to be used if The Gimp
 is not build as console app.

 * plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
 drawable twice
 * plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
 crashing on File/Import

2004-08-01  Simon Budig  <simon@gimp.org>

 * app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
 reset the number of spikes to 2.

2004-08-01  Simon Budig  <simon@gimp.org>

 * app/core/gimpbrushgenerated.[ch]: Added optional spikes for
 the generated brushes, enabling star shaped generated brushes.

 * app/widgets/gimpbrusheditor.[ch]: GUI for this.

 * app/core/gimpbrush.c: changed accordingly.

2004-08-01  DindinX  <david@dindinx.org>

 * plug-ins/common/mapcolor.c
 * plug-ins/common/sample_colorize.c: ported to GimpPreviewArea.

 * plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though
 it should use some pngs instead.

2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>

 * configure.in: modified the checks. hopefully it works on all
 platforms this time.

2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>

 * configure.in: move an AM_CONDITIONAL out of an if block

2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>

 * configure.in: added checks for windres. Fixes bug #148443
 together with my last commit.

2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>

 * app/Makefile.am: added checks and rules to build and link the
 win32 icon resource if the resource compiler windres is found by
 configure. First part of a fix for bug #148443.

2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill

2004-08-01  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/flame/flame.c: ported to GimpPreviewArea.

2004-08-01  Simon Budig  <simon@gimp.org>

 * app/core/core-enums.h
 * app/core/gimpbrushgenerated.[ch]: Implement three different
 brush shapes for generated brushes.

 * app/core/gimpbrush.c: changed accordingly.
 * app/core/core-enums.c: regenerated.

 * app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
 * themes/Default/images/stock-brush-generated-*-16.png: New stock
 icons for the brush shapes.

 * themes/Default/images/Makefile.am
 * libgimpwidgets/gimpstock.[ch]: changed accordingly

 untabified the files touched.

2004-08-01  DindinX  <david@dindinx.org>

 * plug-ins/common/iwarp.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/gqbist.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/fractaltrace.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/exchange.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/emboss.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/diffraction.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/despeckle.c: use even more GimpPreviewArea's
 facilities.

 * plug-ins/common/destripe.c: ported to GimpPreviewArea.

2004-07-31  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gflare/gflare.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/despeckle.c: ported to GimpPreviewArea.

2004-07-31  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/brush.c
 * plug-ins/gimpressionist/orientmap.c
 * plug-ins/gimpressionist/paper.c
 * plug-ins/gimpressionist/preview.c
 * plug-ins/gimpressionist/size.c:
 Converted the code from using GtkPreview to GimpPreviewArea.

2004-07-30  Seth Burgess  <sjburges@gimp.org>

 * plug-ins/common/gauss.c: added some non-interactive modes (if called
 from the pdb with RUN_INTERACTIVE).

2004-07-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorselect.c: minor cleanup.

2004-07-31  Sven Neumann  <sven@gimp.org>

 * libgimp/gimppatternmenu.c: ported to GimpPreviewArea.

 * libgimp/gimpbrushmenu.c: some small changes for consistency.

2004-07-31  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.[ch]: added new function
 gimp_preview_area_fill().

 * libgimpwidgets/test-preview-area.c: added a test for new function.

 * libgimp/gimpbrushmenu.c: ported to GimpPreviewArea.

2004-07-31  DindinX  <david@dindinx.org>

 * plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a
 GtkPreview. Some code cleanup, too.

2004-07-31  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and
 a GdkPixbuf instead of the deprecated GtkPreview widget.

2004-07-30  DindinX  <david@dindinx.org>

 * plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of
 GtkPreview.

2004-07-30  Sven Neumann  <sven@gimp.org>

 Applied a bunch of small changes contributed by Tim Mooney to fix
 stack corruption on Tru64 and Aix (bug #129867).

 * app/Makefile.am
 * plug-ins/script-fu/Makefile.am: changed the dependency order so
 that $(REGEXREPL) is linked earlier.

 * regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream
 fix for re_max_failures value.

2004-07-30  Sven Neumann  <sven@gimp.org>

 * configure.in: always do the check for perl and use the
 substituted perl executable name in the call for gimp-mkenums.
 Fixes the build on platforms where perl is not available as
 /usr/bin/perl. Closes bug #148813.

 * app/widgets/gimpenumstore.c: added missing include.

2004-07-30  DindinX  <david@dindinx.org>

 * plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus
 some minor code cleanups.

2004-07-30  DindinX  <david@dindinx.org>

 * plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a
 GimpPreviewArea and the other to a simple GtkDrawingArea, since this
 makes the code simpler.

2004-07-30  Shlomi Fish  <shlomif@iglu.org.il>

 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
 corrected a typo causing mayhem in previews of non-alpha grayscale
 images. Fixes bug #148873.

2004-07-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/ccanalyze.c (fillPreview): optimized preview
 filling a little bit, removed trailing whitespace.

2004-07-30  DindinX  <david@dindinx.org>

 * plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea,
 and some small cleanups (g_malloc to g_new, removing tabs)

2004-07-30  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
 optimized alpha blending.

2004-07-30  Sven Neumann  <sven@gimp.org>

 Applied a bunch of AIX portability fixes (bug #148813):

 * configure.in: when testing for Xmu library, link with -lXt -lX11.

 * app/gui/tips-parser.c
 * app/gui/user-install-dialog.c
 * app/tools/tools-enums.h
 * app/widgets/gimpdasheditor.c
 * app/widgets/widgets-enums.h
 * libgimpthumb/gimpthumb-error.h
 * libgimpwidgets/gimpcolorbutton.c
 * plug-ins/common/edge.c: removed trailing commas from enums.

 * plug-ins/common/snoise.c: renamed defines to avoid collision
 with system headers.

 * plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

 * app/paint-funcs/paint-funcs-generic.h
 * app/paint-funcs/paint-funcs.c: use integers for bit fields.

2004-07-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/bumpmap.c: removed preview code that isn't used
 any longer.

2004-07-30  DindinX  <david@dindinx.org>

 * plug-ins/common/bumpmap.c: use GimpPreviewArea instead of
 GtkPreview (which leads to much simpler code)

2004-07-29  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppreviewarea.c: only invalidate the buffer
 on size_allocate; allocate a new one on the next call to
 gimp_preview_area_draw(). Fixed buffer offset in expose method.

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/test-preview-area.c: more a benchmark than a
 test; quite similar to testrgb from the GTK+ source tree.

2004-07-29  DindinX  <david@dindinx.org>

 * plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview
 widgets to GimpPreviewArea.

2004-07-29  Michael Natterer  <mitch@gimp.org>

 * libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed
 unused #if 0'ed prototype and unused #includes, minor cleanups.

2004-07-29  Shlomi Fish <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/*.[ch]: normalized the names of the fields
 of gimpressionist_vals_t.

2004-07-29  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgets.def
 * libgimpwidgets/gimpwidgets.h
 * libgimpwidgets/gimpwidgetstypes.h
 * libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a
 replacement for GtkPreview, loosely based on patches from Geert
 Jordaens and David Odin. Fixes bug #144759.

 * plug-ins/common/sharpen.c: use the new widget instead of a
 GtkPreview; saves about 100 lines of rather complex code :)

2004-07-29  Michael Natterer  <mitch@gimp.org>

 * etc/controllerrc: changed default configuration of the keyboard
 controller: scroll the display one step on cursor_key, scroll by
 one page on <shift>+cursor_key and scroll to top/bottom/left/right
 on <control>+cursor_key. Fixes bug #53988.

 Moved the old opacity-modifying actions to <alt>+cursor_key.

2004-07-29  Michael Natterer  <mitch@gimp.org>

 Replaced the concept of having a boolean indicating if an undo
 step dirties the image by a bitfield indicating which parts
 of the image are dirtied:

 * app/core/core-enums.[ch]: reordered two values in enum
 GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.

 The values of GimpDirtyMask are still questionable and will
 probably change...

 * app/core/gimpimage.[ch]: removed signal "undo_start" and added
 a GimpDirtyMask parameter to the "dirty" and "clean" signals.

 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
 "gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
 it to gimp_image_dirty().

 (gimp_image_undo_group_start): added *ugly* code which tries to
 figure GimpDirtyMask from the group's GimpUndoType and store it in
 the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
 gimp_image_undo_start(). This means the undo group now dirties the
 image just like one of its undo steps, but that's no problem since
 undoing cleans it in the same way.

 * app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g

 (gimp_undo_pop): emit clean/dirty signals *before* performing the
 actual undo step so listeners can detach from the image before it
 is changed by undo.

 * app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
 GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().

 * app/core/gimpimagemap.[ch]: removed "gboolean interactive"
 because it makes no sense to use GimpImageMap noninteractively.
 Don't freeze()/thaw() undo while the image_map is active which
 fixes many ways of trashing the image's undo state but probably
 introduces new ways of doing evil things.

 * app/display/gimpdisplay-foreach.c
 * app/display/gimpdisplayshell-handlers.c: changed according
 to the GimpImage::clean()/dirty() signal changes. Small fixes
 in the quit dialog's dirty image container.

 * app/tools/gimptoolcontrol.[ch]: added member and API to
 set/get the dirty_mask.

 * app/tools/gimpcroptool.c
 * app/tools/gimpimagemaptool.c
 * app/tools/gimpiscissorstool.c
 * app/tools/gimptexttool.c
 * app/tools/gimptransformtool.c: whenever setting "preserve" to
 FALSE, also set a "dirty_mask" which specifies on which image
 changes the tool wants to be canceled.

 * app/tools/tool_manager.c: removed "undo_start" connection and
 connect to both "dirty" *and* "clean" to check if the active_tool
 needs to be canceled. Cancel the tool only if the dirty_mask
 passed in the signal has common bits with the tool's dirty_mask.

 Fixes bug #109561 and probably opens some new ones...

2004-07-29  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimp/gimp.def
 * libgimp/gimpui.def: added some missing symbols

2004-07-29  Sven Neumann  <sven@gimp.org>

 * libgimpbase/gimpbase.def: added new symbols.

2004-07-29  Michael Natterer  <mitch@gimp.org>

 Added support for motion event history as provided by some input
 device drivers. If you have a tablet driver supporting this,
 please try and report back.

 * app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
 member "guint32 last_motion_time".

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_tool_events): remember the last_motion_time on
 button_press() and after motion() and ask the current device for
 its motion history; in motion(), if the active_tool asks for exact
 motions, check if the input device recorded a motion history and
 process the history instead of the motion event.

 (gimp_display_shell_get_time_coords): new utility function which
 gets GimpCoords from a GdkTimeCoord struct as used by the motion
 history.

2004-07-29  Shlomi Fish <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/repaint.c: converted a multiple if into
 a nested one.

2004-07-29  Sven Neumann  <sven@gimp.org>

 * app/core/core-enums.h: removed enums GimpImageType and
 GimpImageBaseType ...

 * libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
 all enums from gimpbasetypes.h to this new file.

 * libgimpbase/Makefile.am
 * tools/pdbgen/Makefile.am: changed accordingly.

 * app/core/core-enums.c
 * libgimp/gimpenums.h
 * libgimpbase/gimpbaseenums.c
 * tools/pdbgen/enums.pl: regenerated.

 * libgimpbase/gimpparasite.c
 * libgimpbase/gimpprotocol.c
 * libgimp/gimp.c: include <glib-object.h>

 * libgimpbase/gimpbasetypes.[ch]: added API to set and get a
 translation domain on a GType. This is used for translatable enum
 values.

 * libgimpbase/gimputils.[ch]: added API to retrieve the translated
 name for an enum value.

 * app/widgets/gimpenumstore.c
 * app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.

2004-07-29  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawable.c: fixed gtk-doc comments.

2004-07-29  Dave Neary  <bolsh@gimp.org>

 * app/core/gimpdrawable-transform.c: Stop signed ints overflowing
 while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2.
 Fixes bug #128594 for drawables less than 32K wide.

2004-07-29  Michael Natterer  <mitch@gimp.org>

 * app/gui/preferences-dialog.c: renamed "Cleared saved foobar now"
 buttons to "Reset saves foobar to default values". Fixes bug #5673.
 Added mnemonics for all the configure/save/reset buttons.

2004-07-29  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script):
 applied patch by Kevin Cozens that moves a g_free() to the right
 place (bug #148729).

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/actions/actions.c (action_groups): register the
 GIMP_STOCK_VISIBLE icon with the "view" action group.

2004-07-28  Shlomi Fish <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/brush.c: removed a redundant parameter
 from one of the internal functions.
 * plug-ins/gimpressionist/utils.c: Made sure that resources that
 are selected by the presets will position their list views
 accordingly.

2004-07-28  Sven Neumann  <sven@gimp.org>

 * autogen.sh: if the check for libtoolize fails, try glibtoolize.

2004-07-28  Shlomi Fish <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/presets.c: created a base function for
 two functions with duplicate code.

2004-07-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_default_dialog.c: no need to include
 "libgimp/stdplugins-intl.h" here.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/gui/preferences-dialog.c (prefs_dialog_new): reordered
 buttons in the Interface -> Keyboard Shortcuts section to be
 consistent with other sections which provide configure/save/clear
 buttons.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
 * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
 don't call gimp_tool_control_set_preserve (tool->control, FALSE)
 because these tools don't cache any image state and don't care
 about the image changing under their feet.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
 emit "reconnect" *before* emitting scale and scroll events so
 listeners (the navigation view) can switch to the new image at the
 right time.

2004-07-28  Sven Neumann  <sven@gimp.org>

 Applied a patch from Brion Vibber that makes the TWAIN plug-in
 available on Mac OS X (bug #147962):

 * configure.in
 * plug-ins/Makefile.am: check for Mac OS X twain support.

 * plug-ins/twain/Makefile.am
 * plug-ins/twain/tw_local.h
 * plug-ins/twain/tw_mac.c
 * plug-ins/twain/tw_platform.h
 * plug-ins/twain/tw_win.c: new files with platform specific code.

 * plug-ins/twain/README
 * plug-ins/twain/tw_dump.[ch]
 * plug-ins/twain/tw_func.[ch]
 * plug-ins/twain/tw_util.[ch]
 * plug-ins/twain/twain.c: changed accordingly.

 * plug-ins/twain/gimp-twain.png: twain application icon used by
 the Mac port.

 * plug-ins/twain/tw_sess.c: removed, doesn't seem to be used.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in
 parameter description.

 * app/pdb/image_cmds.c
 * libgimp/gimpimage_pdb.c: regenerated.

2004-07-28  DindinX  <david.odin@cpe.fr>

 * plug-ins/common/unsharp.c: Added a toggle button to enable/disable
 preview updating. Should fix #144972.

2004-07-28  DindinX  <david.odin@cpe.fr>

 * plug-ins/common/shift.c
 * plug-ins/common/sinus.c
 * plug-ins/common/snoise.c
 * plug-ins/common/spheredesigner.c: added missing calls to
 g_rand_free (), remove tabs while I was at it.

 * plug-ins/common/smooth_palette.c: minor cleanup

 * plug-ins/common/spread.c: removed tabs.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/core/core-enums.h: added still unused flags type
 GimpDirtyMask.

 * app/base/Makefile.am
 * app/core/Makefile.am
 * app/display/Makefile.am
 * app/paint/Makefile.am
 * app/text/Makefile.am
 * app/tools/Makefile.am
 * app/widgets/Makefile.am
 * libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
 support GTypeFlags and to make the value arrays private to the
 get_type() functions.

 * app/base/base-enums.c
 * app/core/core-enums.c
 * app/display/display-enums.c
 * app/paint/paint-enums.c
 * app/text/text-enums.c
 * app/tools/tools-enums.c
 * app/widgets/widgets-enums.c: regenerated.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimpclone.c: converted tabs to spaces.

2004-07-28  DindinX  <david.odin@cpe.fr>

 * plug-ins/common/spread.c: fix a smallish memory leak.

2004-07-28  Sven Neumann  <sven@gimp.org>

 * tools/gimp-mkenums: synced with glib-mkenums (execept for the
 newly added template feature).

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * libgimp/gimpbrushselect.c
 * libgimp/gimpfontselect.c
 * libgimp/gimpgradientselect.c
 * libgimp/gimppalettemenu.c
 * libgimp/gimppaletteselect.c
 * libgimp/gimppatternselect.c (gimp_*_select_destroy): don't
 leak the selected object's name and its data (brush mask etc).

 * libgimp/gimpfontmenu.c: moved the icon to the left side of the
 button.

 * libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to
 API docs.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpactiongroup.c
 (gimp_action_group_set_action_label): forgot to strip mnemonics
 here.

2004-07-28  Michael Natterer  <mitch@gimp.org>

 Enabled disabling all menu mnemonics. Addresses bug #120034:

 * app/config/gimpguiconfig.[ch]
 * app/config/gimprc-blurbs.h: added boolean RESTART property
 "menu-menonics".

 * app/gui/preferences-dialog.c: added a GUI for it.

 * app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
 property "mnemonics".

 (gimp_action_group_add_*_actions): call gimp_strip_uline() on
 the actions' labels if mnemonics is FALSE.

 * app/widgets/gimpactionfactory.[ch]
 * app/actions/actions.c: pass gui_config->menu_menmonics to
 all action groups.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * menus/image-menu.xml.in: commented out "Context" menu now that
 we have a shortcut editor.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/core/gimpgradient-load.c: don't leak empty SVG gradients.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/actions/image-commands.c: include "libgimpbase/gimpbase.h",
 not an individual header out of libgimpbase.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * libgimpbase/Makefile.am
 * libgimpbase/gimpbase.h
 * libgimpbase/gimpbase.def
 * libgimpbase/gimpmemsize.[ch]: added new files with memsize
 related functions (moved here from gimputil.c) and
 GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

 * libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

 * libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
 app/config/gimpconfig-types.[ch]).

 * libgimpbase/gimpbase-private.c
 * libgimp/gimptile.c
 * libgimp/gimpunitcache.c
 * plug-ins/help/domain.c
 * app/xcf/xcf-read.c: need to include glib-object.h.

 * plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

 * app/config/gimpconfig-types.[ch]: removed code that lives in
 libgimpbase now.

 * app/config/gimpconfig-deserialize.c: changed accordingly.

 * app/config/gimpbaseconfig.c
 * app/config/gimpdisplayconfig.c
 * app/core/gimpcontext.c
 * app/gui/grid-dialog.c
 * app/tools/gimpcolortool.c
 * app/widgets/gimpaction.c
 * app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
 any longer.

004-07-27  Michael Natterer  <mitch@gimp.org>

 * libgimp/Makefile.am
 * libgimp/gimp.h
 * libgimp/gimpui.h
 * libgimp/gimppalettemenu.[ch]
 * libgimp/gimppaletteselect.[ch]: added palette select wrapper and
 widget (straight copy & string replace of the font select stuff).
 Fixes bug #136130.

 * plug-ins/script-fu/script-fu-enums.h
 * plug-ins/script-fu/script-fu-scripts.c
 * plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can
 be used in scripts.

 * plug-ins/script-fu/scripts/test-sphere.scm: added a palette
 parameter to the test script.

2004-07-27  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage.c (gimp_image_finalize): remove the image
 from the image hash table and set its "gimp" pointer to NULL
 *after* all layers, channels, vectors and the selection are
 finalized; otherwise these items have no chance of removing
 themselves from the item hash table (because image->gimp is
 already NULL). Spotted by pgimeno and nomis.
 (should be backported after it got some testing)

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.

2004-07-27  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
 sure we always set a non-null URI.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp-ids.h removed unused help IDs
 GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
 for these entries are generated from the procedure names.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphelp.c (gimp_help): print the help-id and
 help-domain to stdout if gimp was started with the --verbose
 command-line option.

2004-07-27  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
 show extensions in the filters menu. Is this a good idea at all?

2004-07-27  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpbrushmenu.c
 * libgimp/gimppatternmenu.c: attempt to make the brush and pattern
 selectors look less like buttons (supposed to fix bug #147777).

2004-07-27  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events):
 also accept the short hexadecimal notation (3 hex digits).

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS):
 added new files.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

 * app/widgets/gimpcomponenteditor.c
 * app/widgets/gimpcontainertreeview.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimptoolview.c
 * app/widgets/widgets-types.h: changed accordingly.

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgets.def
 * libgimpwidgets/gimpwidgets.h
 * libgimpwidgets/gimpwidgetsmarshal.list
 * libgimpwidgets/gimpwidgetstypes.h
 * libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
 renderer moved here from app/widgets.

 * libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
 new toggle cell renderer.

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/pdb/procedural_db.[ch] (procedural_db_free_data): new
 function which clears the whole list of data set by plug-ins.

 (procedural_db_free): use it.

 * app/actions/plug-in-actions.c
 * app/actions/plug-in-commands.[ch]: added action, callback and
 confirmation dialog for "Reset all filters to default values".
 Somehow addresses bug #81015.

 * app/widgets/gimphelp-ids.h: added a help ID for the new action.

 * menus/image-menu.xml.in: added it to the "Filters" submenu.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcellrenderercolor.c
 (gimp_cell_renderer_color_get_size): fine-tuning.

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

 * app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
 to GimpParamSpecRGB.

 * app/config/gimpconfig-deserialize.c
 * app/config/gimpconfig-dump.c
 * app/config/gimpconfig-serialize.c
 * app/config/gimpscanner.c
 * app/core/gimp-utils.c
 * app/core/gimpcontext.c
 * app/core/gimpgrid.c
 * app/display/gimpdisplayoptions.c
 * app/text/gimptext.c
 * app/tools/gimpcolortool.c
 * app/widgets/gimpaction.c
 * app/widgets/gimpcolorbar.c
 * app/widgets/gimppropwidgets.c: changed accordingly.

2004-07-26  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: added a de-allocation to the PPM's
 allocated by the size map dialog.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * app/core/gimpgradient-load.c: load all linear gradients from an
 SVG file, not only the first one.

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdatafactory.h: added "gboolean writable" to the
 GimpDataFactoryLoaderEntry struct. Return a GList* instead of
 GimpData* from GimpDataLoadFunc so it's possible to load more than
 one data object from one file.

 * app/core/gimpdatafactory.c (gimp_data_factory_load_data):
 changed accordingly: add all items of the returned lists to the
 data factory. Make the data object writable only if it's in the
 writable path *and* its loader entry says it's a writable format
 *and* the returned list contains exactly one element.

 * app/core/gimp.c (gimp_real_initialize): declare all loader
 entries as writable where we have code to read and write exactly
 one object per file; all others are not writable.

 * app/core/gimpbrush.[ch]
 * app/core/gimpbrushgenerated.[ch]
 * app/core/gimpbrushpipe.[ch]
 * app/core/gimpgradient-load.[ch]
 * app/core/gimppalette.[ch]
 * app/core/gimppattern.[ch] (all load functions): return a list
 containing the loaded object instead of the object itself.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgets.def
 * libgimpwidgets/gimpwidgets.h
 * libgimpwidgets/gimpwidgetstypes.h
 * libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell
 renderer.

 * libgimpwidgets/gimpcolorarea.[ch]: exported the function that
 renders the color to a buffer for internal use in libgimpwidgets.

 * libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer
 for the completion popup.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimpcolor.def
 * libgimpwidgets/gimpwidgets.def: added new symbols.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type.

 * libgimpcolor/gimpadaptivesupersample.c
 * libgimpcolor/gimpcolorspace.c
 * libgimpcolor/gimprgb-parse.c
 * libgimp/gimp.h: include <glib-object.h> instead of <glib.h>.

2004-07-26  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: placed all the orientation map-related
 public functions in orientmap.h. Now we're freeing the PPM's that it
 is allocating by a call to orientation_map_free_resources().

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/core/core-types.h: removed unused typedef
 GimpDataObjectLoaderFunc.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb-parse.c
 * libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names()
 that gives access to the list of SVG color keywords.

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgets.h
 * libgimpwidgets/gimpwidgetstypes.h
 * libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that
 allows to enter colors in hex notation or by using color names.

 * libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry.

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
 to gimp_edit_selection_tool_start(). Removed enum EditType.

 * app/tools/tools-enums.h: added enum GimpTranslateMode instead.

 * app/tools/gimpmovetool.c: changed accordingly.

 * app/tools/gimpselectiontool.[ch]: added protected utility
 function gimp_selection_tool_start_edit().

 * app/tools/gimpfreeselecttool.c
 * app/tools/gimpfuzzyselecttool.c
 * app/tools/gimprectselecttool.c: use the new function instead of
 duplicating the same code three times, don't include
 "gimpeditselectiontool.h".

 * app/tools/gimpiscissorstool.c: don't include
 "gimpeditselectiontool.h".

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
 image's undo to prevent live-movement from ending up on the undo
 stack. Instead, just stop pushing undo steps after the initial
 movement. Simplifies edit_select's undo code quite a bit and fixes
 bug #148458.

2004-07-26  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events):
 accept SVG color names in the hex entry. Not very intuitive but
 probably a nice experts feature and it can be improved later.

2004-07-26  Michael Natterer  <mitch@gimp.org>

 * app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking
 at GIMP_MINOR_VERSION.

 * app/app_procs.c: don't #include "tools/gimp-tools.h".

2004-07-26  Sven Neumann  <sven@gimp.org>

 * plug-ins/bmp/bmp.h
 * plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that
 fixes extra data overflow, nonstandard 16bpp field arrangement
 and unrecognized compression (bug #143682).

2004-07-25  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/decompose.c: clamp results of LAB decomposition
 so that out-of-gamut conversions do not overflow and get badly
 distorted.  Fixes bug #147603.  Note that it would probably be a
 good idea to do similar things for other conversion types.

2004-07-25  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: converted checks for initialization of
 ppm's done by checking the "col" buffer, to macro calls.

2004-07-25  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst
 crashes if given malicious presets with out of range values, in
 the radio buttons group numeric values: "placetype", "orienttype",
 etc. ").

 This was done by adding clamps to the relevant values in the preset.

2004-07-25  Raphaël Quinet  <quinet@gamers.org>

 * INSTALL: Minor fixes and improvements.  Suggest using a
 different prefix and setting PKG_CONFIG_LIBDIR if old versions of
 GTK+ libs are found and cannot be removed without breaking other
 packages.

2004-07-23  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: created a header "orientation.h"
 for the Orientation tab specific declarations.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code
 for grayscale previews.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * app/core/gimpgradient-load.c (svg_parser_end_element): fixed
 handling of the last gradient segment and did some code cleanup.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved
 error message.
 (svg_parser_end_element): don't crash on empty gradient definitions.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/test-color-parser.c: added more test samples.

 * libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the
 new tests.

 * app/core/gimpgradient-load.c: changed SVG parser to handle
 gradients that are defined more deeply in the SVG hierarchy. Added
 a simplistic CSS style parser to deal with gradient definitions
 that use CSS to define the gradient stop properties (closes bug
 #148127).

2004-07-23  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdatafactory.c: some newlines to improve error
 messages.

 * app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed
 error handling.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/Makefile.am
 * libgimpcolor/test-color-parser.c: added a simple unit test
 framework for the color parser.

 * libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values.

 * libgimpmath/test-md5.c: minor cleanup.

2004-07-23  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support
 for the "transparent" color name.

2004-07-22  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb-parse.c
 * libgimpcolor/gimprgb.h: improved the CSS color parser code,
 added new function gimp_rgba_parse_css(), added support for HSL
 color values.

2004-07-22  Sven Neumann  <sven@gimp.org>

 * libgimpcolor/gimprgb-parse.c
 * libgimpcolor/gimprgb.h: use a signed integer to pass the string
 length to the new parser functions. The API explicitely asks for
 -1 to be passed...

 * app/core/gimp.c
 * app/core/gimpgradient-load.[ch]
 * app/core/gimpgradient.h: added preliminary support for loading
 simple SVG gradients (see bug #148127).  Be careful with this new
 feature; editing the loaded gradient will cause the SVG file to be
 overwritten! Work in progress...

2004-07-22  Sven Neumann  <sven@gimp.org>

 * app/core/Makefile.am
 * app/core/gimpgradient-load.[ch]
 * app/core/gimpgradient-save.[ch]
 * app/core/gimpgradient.[ch]: moved gradient file handling out of
 gimpgradient.c to new files.

 * app/core/gimp.c
 * app/actions/gradients-commands.c: changed accordingly.

 * libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name.

2004-07-22  Michael Natterer  <mitch@gimp.org>

 * data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax.

2004-07-22  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpactionview.c: rephrased the text for the dialog
 that appears if a new shortcut collides with an existing one.

 * libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
 which accepts RGB colors in hexadecimal notation or as SVG color
 keywords.

2004-07-22  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c (gimp_display_shell_resume):
 s/pause/resume/ in the API docs.

2004-07-22  Michael Natterer  <mitch@gimp.org>

 * tools/gimp-remote.c (main): correctly convert relative paths to
 URIs. Append the resulting URI only if it's not NULL.

2004-07-22  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
 "accel-changed" of the accel_group using connect_object(), not
 just connect() so we don't crash when it's emitted after the
 toolbox is destroyed.

2004-07-21  Ray Strode  <rstrode@redhat.com>

 * gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop
 file for new MIME system.

2004-07-21  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/gif.c: declared global const variable as static.
 Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why).

2004-07-21  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimptemplateeditor.c
 * plug-ins/common/gif.c
 * plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
 text views. Fixes bug #148025.

2004-07-21  Michael Natterer  <mitch@gimp.org>

 Enabled the various "Clear saved foobar now" buttons in prefs:

 * app/gui/session.[ch]
 * app/menus/menus.[ch]
 * app/widgets/gimpdevices.[ch]: implemented the _clear()
 functions: unlink() the rc file and set an internal flag that it
 has been deleted. Added "gboolean always_save" parameter to the
 _save() functions and don't save anything if it is FALSE and the
 internal deletion flag has been set.

 * app/gui/gui.c
 * app/widgets/gimpdevicestatus.c: changed accordingly.

 * app/gui/preferences-dialog.c: added callbacks for all "Save now"
 and "Clear now" buttons and show error messages if clearing fails.
 Inform the user that she has to restart GIMP to see the effect of
 the clearing.

2004-07-21  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpmarshal.list
 * app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
 parameter to the GimpCellRendererAccel::accel_edited() signal.

 * app/widgets/gimpactionview.c: distinguish between deletion of an
 accelerator and the user entering an invalid accelerator.

2004-07-21  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: normalized the identifiers in
 placement.c.

2004-07-21  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c: changed names of actions which
 select brushes, patterns etc. from e.g. "context-brush-first" to
 "context-brush-select-first".

 * menus/image-menu.xml.in: changed accordingly.

2004-07-21  Michael Natterer  <mitch@gimp.org>

 * app/gui/preferences-dialog.c: remember the keyboard shortcut
 dialog and show it only once.

 * app/widgets/gimpactionview.c
 * app/widgets/gimpcellrendereraccel.c: minor cleanups.

 Seems to work pretty well now and thus fixes bug #142922.

2004-07-21  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpmarshal.list
 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
 which displays an accelerator and allows to edit it (ripped
 out of libegg and modified).

 * app/widgets/gimpactionview.c: use the new renderer and connect
 to its "accel-edited" signal (its callback is one huge mess that
 needs to be cleaned up). Added ugly hack to work around GTK+ API
 limitation that seems to prevent implementing a shortcut editor in
 a sane way.

 * app/actions/file-actions.c
 * app/actions/image-actions.c
 * app/actions/tools-actions.c: added ugly hacks here, too.

 * app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
 editor by Close.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that
 the missing po files have been added (tips/pa.po is still missing
 though).

2004-07-20  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpactionfactory.[ch]
 * app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
 properties to GtkActionGroup and allow to register them in the
 GimpActionFactory.

 * app/actions/actions.c: register user visible labels and icons
 with all action groups.

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpactionview.[ch]: new widget which shows a
 treeview of action groups and their actions & shortcuts.

 * app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
 utility function.

 * app/widgets/gimpwidgets-utils.[ch]: added
 gimp_get_accel_string() utility function.

 * app/widgets/gimpcontrollers.[ch]: added
 gimp_controllers_get_ui_manager() which will be used for setting
 up the controller mapping dialog.

 * app/gui/preferences-dialog.c: added a "Configure Keyboard
 Shortcuts" button which pops up a GimpActionView. Work in
 progress...

2004-07-20  Michael Natterer  <mitch@gimp.org>

 * app/actions/image-actions.c: make sure that the "image-new" and
 "image-new-from-image" actions always have the same shortcut.

2004-07-20  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/Lighting/lighting_main.c
 * plug-ins/Lighting/lighting_main.h
 * plug-ins/Lighting/lighting_preview.c
 * plug-ins/Lighting/lighting_preview.h
 * plug-ins/Lighting/lighting_shade.c
 * plug-ins/Lighting/lighting_ui.c: completely reworked UI for
 lighting page.  Now supports up to 6 lights (more is trivial).
 Added ability to temporarily isolate selected light.  Added
 light intensity controls.  Can interactively position each light
 (does not quite work yet for directional lights).

2004-07-20  Michael Natterer  <mitch@gimp.org>

 * app/actions/tools-actions.c: added an icon to the
 "tools-visibility" action.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * app/composite/gimp-composite.c (gimp_composite_init): now that
 the output depends on --verbose, enable it for stable releases also.

2004-07-20  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/presets.c: fixed the incorrect strings
 for input and output of the preset's fields. (a relic of an
 irresponsible search-and-replace script).

 * plug-ins/gimpressionist/: normalized the identifiers of
 orientmap.c.

2004-07-20  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/Makefile.am (regenerate): Updated make-installer.py
 command line to take advantage of the new compile time method of
 determining which instruction set to compile.

 * app/composite/gimp-composite.c (gimp_composite_init): Print the
 list of active instruction sets if the --verbose command line
 switch is ON (via be_verbose)

 * app/composite/gimp-composite-x86.h: Factored code from the mmx,
 and sse implementations.

 * app/composite/make-installer.py: Raised the number of test
 iterations from 1 to 10.

 * app/composite/gimp-composite-3dnow.[ch]
 * app/composite/gimp-composite-3dnow-test.c
 * app/composite/gimp-composite-3dnow-installer.c
 * app/composite/gimp-composite-altivec.[ch]
 * app/composite/gimp-composite-altivec-test.c
 * app/composite/gimp-composite-altivec-installer.c
 * app/composite/gimp-composite-mmx.[ch]
 * app/composite/gimp-composite-altivec-test.c
 * app/composite/gimp-composite-altivec-installer.c
 * app/composite/gimp-composite-sse.[ch]
 * app/composite/gimp-composite-sse-test.c
 * app/composite/gimp-composite-sse-installer.c
 * app/composite/gimp-composite-sse2.[ch]
 * app/composite/gimp-composite-sse2-test.c
 * app/composite/gimp-composite-sse2-installer.c
 * app/composite/gimp-composite-vis.[ch]
 * app/composite/gimp-composite-vis-test.c:
 Regenerated sources via make-installer.py

2004-07-20  Sven Neumann  <sven@gimp.org>

 * app/app_procs.c
 * app/base/base.[ch]
 * app/composite/gimp-composite.[ch]: pass "be_verbose" to the base
 and composite subsystems.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * autogen.sh: added some empty lines to improve readability of the
 output in case of problems.

 * configure.in: bumped version number to 2.1.3.

2004-07-19  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-mmx.c
 (xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx)
 * app/composite/gimp-composite-mmx.c
 (xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx)
 * app/composite/gimp-composite-mmx.c
 (gimp_composite_difference_rgba8_rgba8_rgba8_mmx)
 * app/composite/gimp-composite-mmx.c
 (gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber
 register corrections.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * Made 2.1.2 release.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/winicon/icoload.c
 * plug-ins/winicon/icosave.c: added explicit casts to please the
 compiler.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/gimpressionist/Makefile.am (gimpressionist_sources):
 added paper.h.

 * plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back
 arcball.h.

 * plug-ins/MapObject/mapobject_main.c
 * plug-ins/MapObject/mapobject_preview.c: no need to include
 arcball.h here.

 * plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples

 * plug-ins/gfig/gfig-examples/Makefile.am: cleanup.

2004-07-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/Lighting/lighting_ui.c: fixed some GUI issues:
 left-align labels, use stock buttons, added line-breaks to make
 the code fit into 80 columns.

2004-07-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with
 the new code: don't include individual glib headers, never ever
 use sprintf(), mark user-visible strings for translations, use
 default messages, removed trailing whitespace.

2004-07-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/Lighting/lighting_ui.c: added ability to save and load
 presets for lights.

2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/orientation.c: normalized some variables
 in the module and fixed some indentation.

2004-07-19  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-mmx.c
 (gimp_composite_addition_rgba8_rgba8_rgba8_mmx)
 * app/composite/gimp-composite-mmx.c
 (gimp_composite_burn_rgba8_rgba8_rgba8_mmx)
 * app/composite/gimp-composite-x86.h: Correction of clobbered
 register lists, as additional progress against bug #147013.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpmarshal.list: removed unused VOID:UINT,STRING.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/gui/file-open-location-dialog.c
 (file_open_location_dialog_show): added the "web" icon left of
 label & entry.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.

 * app/paint/paint-enums.h: added enum GimpPaintState (with values
 that have a name space).

 * app/paint/gimppaintcore.[ch]
 * app/paint/gimpairbrush.c
 * app/paint/gimpbrushcore.c
 * app/paint/gimpclone.c
 * app/paint/gimpconvolve.c
 * app/paint/gimpdodgeburn.c
 * app/paint/gimperaser.c
 * app/paint/gimpink.c
 * app/paint/gimppaintbrush.c
 * app/paint/gimppaintcore-stroke.c
 * app/paint/gimpsmudge.c
 * app/tools/gimppainttool.c: changed accordingly.

 * app/tools/gimpinktool.c: removed unused #include.

2004-07-19  Sven Neumann  <sven@gimp.org>

 * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
 moved variable declarations to the scope they are being used in,
 removed trailing whitespace, minor cleanups.

2004-07-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpchannel-combine.c: put in two lines accidentally
 omitted in previous change, improve doc comment.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * libgimpbase/gimpwin32-io.h: added copyright header, added
 #defines for access(), F_OK, R_OK and X_OK.

 * app/core/gimpdata.c: include the above instead of defining
 the workarounds here.

 * app/base/tile-swap.c
 * app/config/gimpconfig-dump.c
 * libgimpthumb/gimpthumb-utils.c
 * libgimpthumb/gimpthumbnail.c: for consistency, #include
 gimpwin32-io.h with "" instead of <>.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
 comments not intended for gtk-doc must not start with '/**'.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-in.h (struct _PlugIn): removed obsolete
 compile-time check for GLIB >= 2.3.5.

2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>

 * ChangeLog: Fixed a copy-and-paste error with the dates of my commits.
 * plug-ins/gimpressionist/ppmtool.c: removed a few commented-out
 asserts, and the function that was used to implement them.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/widgets/widgets-types.h: reordered and commented to match
 API docs.

2004-07-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/imagemap/imap_browse.[ch]: renamed struct member
 file_selection to file_chooser.

2004-07-19  Michael Natterer  <mitch@gimp.org>

 * app/config/config-types.h: removed GimpConfigInterface typedef,
 added comments to typedefs which don't belong here.

 * app/config/gimpconfig.h: added GimpConfigInterface typedef.

 * app/core/core-types.h
 * app/display/display-types.h: added commented out typedefs for
 types that live in config-types.h for obscure reasons.

 * app/core/core-types.h: reordered stuff to match the order in the
 API docs (makes keeping stuff in sync much easier).

2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors
 pairs for ppm_ with just the destructors.

2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/repaint.c: normalized some identifiers of
 repaint.c, and corrected some indentation there.

2004-07-18  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpchannel-combine.c: improve anti-aliasing for
 elliptical selections, as described in bug #147836.

2004-07-18  Sven Neumann  <sven@gimp.org>

 * app/composite/gimp-composite-mmx.h: don't start a comment with
 /** unless it's meant to be parsed by gtk-doc.

 * app/actions/Makefile.am:
 * app/actions/file-dialog-commands.[ch]: removed, not used any
 longer.

2004-07-18  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/paint/gimpink-blob.c (blob_make_convex): Check if the
 array index is legal before using it, not the other way around.
 Fixes bug #144856.

2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/polar.c (dialog_update_preview): Fixed a
 write to unallocated memory that was causing crashes in various
 spots.

2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/polar.c (polarize_func): moved array
 initialization out of variable declaration. Fixes bug #147799.

2004-07-17  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimphelp-ids.h: added the removed help IDs back.

 * app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
 IDs and added gimp_file_proc_view_get_help_id() which returns the
 selected item's help ID.

 * app/widgets/gimpfiledialog.c: added a custom help func which
 shows the help for the selected file_proc if the proc_view has the
 focus.

2004-07-17  Sven Neumann  <sven@gimp.org>

 * app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
 for "file-open-location".

 * app/widgets/gimpfiledialog.c: create the scrolled window with
 shadow_type GTK_SHADOW_IN.

 * app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
 procedures that register a prefix (the URL loader).

 * app/widgets/gimphelp-ids.h: removed help IDs that used to be
 used from the file-open and file-save menus.

 * plug-ins/common/xwd.c (query): "X window dump" seems to be more
 appropriate than "X window image".

2004-07-17  Sven Neumann  <sven@gimp.org>

 * app/actions/Makefile.am
 * app/actions/file-dialog-actions.[ch]
 * app/actions/file-open-actions.[ch]
 * app/actions/file-save-actions.[ch]: these aren't needed any
 longer.

 * app/actions/actions.c: changed accordingly.

 * app/menus/Makefile.am
 * app/menus/file-dialog-menu.[ch]
 * app/menus/file-open-menu.[ch]
 * app/menus/file-save-menu.[ch]: these aren't needed any longer.

 * app/menus/menus.c: changed accordingly.

 * menus/Makefile.am
 * menus/file-open-menu.xml
 * menus/file-save-menu.xml: these are also not needed any longer.

2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from
 Brion Vibber that fixes corruption when saving RLE-encoded
 BMPs on big endian hosts. Fixes bug #147759.

2004-07-17  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: normalized the identifiers of
 general.c and general.h. Also, renamed a callback from _store
 to simply _callback to avoid confusion with the _store methods.
 Some of the member variables of the pcvals struct were changed
 as a result.

2004-07-16  Helvetix Victorinox  <helvetix@gimp.org>

 * app/composite/gimp-composite-mmx.[ch]
 * app/composite/gimp-composite-sse.[ch]
 * app/composite/gimp-composite-sse2.[ch]:

 We've had trouble compiling with the Intel compiler which
 identifies itself as GCC, but doesn't support the same extended
 assembly features/misfeatures as GCC.  With the help of the Intel
 compiler group, we've determined that the Intel compiler can be
 identified at compile time by the definition of the preprocessor
 variable __INTEL_COMPILER.

 These changes make all of the assembly code currently written to
 simply avoid the Intel compiler.

 This is an interim solution to get a build working despite the
 Intel compiler.  A more correct solution has been identified, see
 the discussion of bug #147013 for more information.

2004-07-17  Sven Neumann  <sven@gimp.org>

 * app/xcf/xcf.c (xcf_init): also register the internal XCF
 handlers according to the new scheme.

 * plug-ins/common/Makefile.am
 * plug-ins/common/plugin-defs.pl
 * plug-ins/common/hrz.c: removed the HRZ file plug-in since it
 doesn't seem to be very useful.

2004-07-17  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
 (plug_ins_init_file): use g_slist_prepend() instead of
 g_slist_append().

 * plug-ins/common/url.c (query): ported to the new PDB registration
 scheme.

2004-07-16  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
 by their menu labels.

 * app/widgets/gimpfileprocview.c: removed the sort function here.

2004-07-16  Sven Neumann  <sven@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpfileprocview.[ch]: added new widget that offers
 a treeview on file procedures.

 * app/widgets/gimpfiledialog.[ch]: replaced the file type option
 menu with the new GimpFileProcView widget.
 (gimp_file_dialog_set_image): reset the file type to Automatic
 (fixes bug #141535).

 * app/actions/file-commands.c
 * app/gui/file-open-dialog.[ch]
 * app/gui/file-save-dialog.[ch]: changed accordingly.

 * plug-ins/common/bz2.c
 * plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
 extension. It's redundant and breaks the code that sets the
 extension from the selected file-type.

 * plug-ins/common/dicom.c: register a shorter menu label.

 * plug-ins/common/gbr.c
 * plug-ins/common/gih.c
 * plug-ins/common/pat.c
 * plug-ins/common/url.c: register stock icons.

2004-07-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/Lighting/lighting_main.[ch]
 * plug-ins/Lighting/lighting_preview.[ch]
 * plug-ins/Lighting/lighting_shade.c
 * plug-ins/Lighting/lighting_ui.c:  Made this plug-in support
 multiple light sources; implemented three, architecture now
 supports any number.  Changed material properties to more intuitve
 names; added "metallic" property.  Cleaned out some unused,
 commented-out code.

2004-07-16  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of
 "libgimpbase/gimpparasite.h" for getting the GimpParasite type.

 * tools/pdbgen/app.pl
 * tools/pdbgen/pdb/drawable.pdb
 * tools/pdbgen/pdb/edit.pdb
 * tools/pdbgen/pdb/gradients.pdb
 * tools/pdbgen/pdb/guides.pdb
 * tools/pdbgen/pdb/image.pdb: removed redundant #includes.

 * tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic.
 Consistently fail if there is no currently queried plugin.

 * app/pdb/*.c: regenerated.

2004-07-16  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-transform.c: made gtk-doc even
 happier; clarified meaning of the "use_offsets" parameter.

2004-07-16  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdata.c:
 * app/display/gimpcanvas.c:
 * app/display/gimpdisplayshell.c
 * app/display/gimpdisplayshell-transform.c: corrected API
 documentation, removed trailing whitespace.

 Please do always build the documentation if you add or change any
 gtk-doc comments.

2004-07-15  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/display/gimpcanvas.c:
 * app/display/gimpdisplayshell-transform.c: added gtk-doc
 comments for all public functions that lack them.

 * app/display/gimpdisplayshell.c: added a couple of
 gtk-doc comments.

2004-07-15  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpdata.c: added gtk-doc comments for
 public functions.

2004-07-15  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: normalized the identifiers of
 paper.c and paper.h. Made one variable local to the function
 instead of module static.

2004-07-15  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: normalized the ppmtools.c and
 ppmtool.h identifiers. Also fixed some (but not all) of the
 syntax.

2004-07-15  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/winicon/icoload.c:
 * plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber
 that fixes byte-swapping on big endian hosts. Fixes bug #147610.

2004-07-15  Sven Neumann  <sven@gimp.org>

 * plug-ins/helpbrowser/dialog.c
 * plug-ins/helpbrowser/uri.c: don't warn if no help pages are
 installed and the Home button is clicked.

2004-07-15  Michael Natterer  <mitch@gimp.org>

 * app/file/file-open.c (file_open_layer): don't crash if no
 layer or only one layer is visible. Fixes bug #143804.

 * app/app_procs.c (app_run): fixed log domain registration.

2004-07-15  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpviewable.[ch]: corrected API docs and fixed
 function parameter names to silent gtk-doc warnings.

2004-07-15  Michael Natterer  <mitch@gimp.org>

 * app/app_procs.c (app_run): register a log handler for the
 "Gimp-Menus" domain.

2004-07-15  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/mng.c: cleanup.

2004-07-15  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/core/gimpviewable.c: added gtk-doc comments for public
 functions.

2004-07-15  Michael Natterer  <mitch@gimp.org>

 * app/actions/file-commands.h: reordered to match the .c file.

 * app/core/gimpitem.c
 * app/vectors/gimpvectors-import.c: fixed API docs.

2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/png.c:
 * plug-ins/common/mng.c: Fixed erroneously reported warning
 message when saving indexed layers with an alpha channel but
 no transparent pixels.

2004-07-14  Sven Neumann  <sven@gimp.org>

 * app/app_procs.c (app_run): register a log handler for the
 "Gimp-Actions" domain.

2004-07-14  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * devel-docs/objects.txt: . . . and removed because it is
 redundant with devel-docs/app/app.hierarchy.

2004-07-14  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * devel-docs/objects.txt:  added file containing a map of Gimp's
 GObject hierarchy .

2004-07-14  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpstatusbar.[ch]: massively changed: removed
 message_ids, the message mem chunk and all signals. Added new
 function gimp_statusbar_replace() which updates a message without
 moving it to the top of the stack. Fixes bug #120175.

 * app/display/gimpdisplayshell-title.[ch]: renamed
 gimp_display_shell_update_title() to
 gimp_display_shell_title_update() and switched from pop()/push()
 to replace() so the title message keeps its place in the stack.
 Added new function gimp_display_shell_title_init() which push()es
 the title message to the stack.

 * app/display/gimpdisplayshell.c (gimp_display_shell_new): call
 gimp_display_shell_title_init() so the "title" message is at the
 bottom of the stack.

 * app/display/gimpdisplayshell-callbacks.c
 * app/display/gimpdisplayshell-handlers.c: changed accordingly.

2004-07-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-console.[ch]
 * plug-ins/script-fu/script-fu.c
 * plug-ins/script-fu/siod-wrapper.[ch]
 * plug-ins/script-fu/siod/slib.c: applied a patch from Kevin
 Cozens that removes an unneeded pipe which was causing problems
 on long output from the SIOD interpreter (bug #139200). Also
 shortened the welcome message.

2004-07-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/pagecurl/pagecurl.c: GUI polishing.

2004-07-14  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: Added more underscores to identifiers.
 Fixed some of the style issues (added whitespace before the '(' in
 function calls).

2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/mng.c: Now writes a global palette chunk, and
 empty palette chunks for the frames that use it. This saves a
 bit of diskspace.

2004-07-14  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpimage.c: added properties "gimp", "id", "width",
 "height" and "base-type". Moved all code from gimp_image_new()
 to GObject::constructor().

 * app/core/gimpimage-convert.c
 * app/core/gimpimage-crop.c
 * app/core/gimpimage-resize.c
 * app/core/gimpimage-rotate.c
 * app/core/gimpimage-scale.c
 * app/core/gimpimage-undo-push.c: set "width", "height" and
 "base-type" with g_object_set() so "notify" is emitted on the
 properties.

 * app/core/gimpimage-undo.c (gimp_image_undo_pop_stack):
 freeze/thaw property notifications around undoing/redoing so they
 are not emitted in the middle of the undo operation.

2004-07-14  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpitem.c: converted tabs to spaces, cleanup,
 reviewed new API docs.

2004-07-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tiff.c: applied a patch done by Brion Vibber
 and Philip Lafleur that fixes loading of CMYK TIFF images on
 big-endian hardware (bug #147328).

2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/mng.c (respin_cmap): Properly check the return
 value of find_unused_ia_color(). The plugin will now save indexed
 MNGs correctly; fixes bug #139947. Also converted tabs to spaces.

2004-07-14  Michael Natterer  <mitch@gimp.org>

 Code review & cleanup:

 * app/config/gimpguiconfig.[ch]: removed transparency-size,
 transparency-type and snap-distance properties...

 * app/config/gimpdisplayconfig.[ch]: ...and added them here.

 * app/display/gimpdisplayshell.c
 * app/tools/gimpmovetool.c: changed accordingly.

 * app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
 "max_memsize" parameter instead of looking it up in GimpGuiConfig.

 * app/actions/image-commands.c: changed accordingly.

 * app/core/gimparea.c
 * app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

 * app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
 GimpProjectionIdleRender, reordered functions, cleanup.

 * app/display/gimpdisplay-handlers.c
 * app/display/gimpdisplay.c: removed unused #includes.

 * app/display/gimpdisplayshell.[ch]
 * app/display/gimpdisplayshell-close.c: renamed
 shell->warning_dialog to shell->close_dialog, some random
 cleanups.

 * app/display/gimpdisplayshell-handlers.c
 * app/widgets/gimpselectioneditor.c: minor coding style cleanup.

2004-07-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * app/core/gimpitem.c: added documentation comments to some
 of the functions.

2004-07-14  Michael Natterer  <mitch@gimp.org>

 * app/display/Makefile.am
 * app/display/gimpdisplayshell-close.[ch]: new files for
 gimp_display_shell_close() and its dialog & callback.

 * app/display/gimpdisplayshell.[ch]: removed from here.

 * app/actions/view-actions.c (view_close_view_cmd_callback):
 changed accordingly.

2004-07-14  Sven Neumann  <sven@gimp.org>

 * plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of
 a plethora of booleans. Added some macros for readability. Allow
 to use a reversed gradient for colorizing the curl.

2004-07-14  Michael Natterer  <mitch@gimp.org>

 * app/core/Makefile.am
 * app/core/core-types.h
 * app/core/gimppickable.[ch]: new interface which has
 get_image_type(), get_tiles() and get_color_at() methods.

 * app/core/gimpdrawable.[ch]
 * app/core/gimpimagemap.[ch]
 * app/core/gimpprojection.[ch]: implement GimpPickableInterface
 and removed public get_colot_at() functions.

 * app/core/gimpimage-pick-color.[ch]: removed typedef
 GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
 gimp_pickable_pick_color() instead.

 * app/core/gimpimage-contiguous-region.c
 * app/core/gimpimage-crop.c
 * app/gui/info-window.c
 * app/paint/gimpconvolve.c
 * app/paint/gimpsmudge.c
 * app/tools/gimpbycolorselecttool.c
 * app/tools/gimpimagemaptool.c
 * app/widgets/gimpselectioneditor.c: use GimpPickable functions
 instead of the various get_color_at() functions. Simplifies code
 which has a "sample_merged" boolean. Various cleanups.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/presets.c: Added underscores between
 words in function names according to the GIMP's (and common
 sense) convention.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: Moved the global declarations of
 img_has_alpha and create_colorpage to more specialized headers.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/: Added the paper.h header for the functions
 defined in the paper.c module. (thus removing more declarations
 from gimpressionist.h)

2004-07-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-preview.[ch}
 * plug-ins/gfig/gfig.h: Made Cancel work properly.  Moved "show grid",
 "snap to grid", and "show image" checkbuttons back onto main
 interface.  Eliminated GtkPreview and removed undef of
 GTK_DISABLE_DEPRECATED from gfig-preview.c.  Removed some
 unused code.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/gflare/gflare.c (preview_handle_idle): use
 gtk_widget_queue_draw_area() instead of the deprecated
 gtk_widget_draw() routine.

 * plug-ins/gimpressionist/orientmap.c
 * plug-ins/gimpressionist/paper.c
 * plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw()
 instead of the deprecated gtk_widget_draw() routine.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/preview.c
 * plug-ins/gimpressionist/sizemap.c:
 eliminated two compile-time warnings.

2004-07-13  Michael Natterer  <mitch@gimp.org>

 Added a GimpProjection object which maintains the idle projection
 logic that was in GimpDisplay and takes care of constructing the
 projection even without any display open. Makes color picking and
 other reads from the projection work without display and fixes the
 major bug that we were constructing the projection n times (!)
 for n displays.

 * app/core/Makefile.am
 * app/core/gimpimage-projection.[ch]: removed.

 * app/core/core-types.h
 * app/core/gimpmarshal.list
 * app/core/gimparea.[ch]
 * app/core/gimpprojection.[ch]
 * app/core/gimpprojection-construct.[ch]: new files assembled from
 the pieces of gimpdisplay.c and gimpimage-projection.c.

 * app/core/gimpimage.[ch]: create a GimpProjection.
 Removed explicit projection realloc calls because the projection
 connects to the relevant GimpImage signals now.
 Added gimp_image_coords_in_active_drawable().

 * app/display/Makefile.am
 * app/display/gimpdisplay-area.[ch]: removed.

 * app/display/gimpdisplay.[ch]: stripped away the idle render stuff
 and just keep a list of update_areas which is painted on flush().
 Removed gimp_display_coords_in_active_drawable().

 * app/display/gimpdisplay-foreach.[ch]: removed
 gimp_display_finish_draw().

 * app/core/gimpchannel.c
 * app/core/gimpimage-contiguous-region.c
 * app/core/gimpimage-convert.c
 * app/core/gimpimage-crop.c
 * app/core/gimpimage-merge.c
 * app/core/gimpimage-pick-color.c
 * app/core/gimpimage-scale.c
 * app/core/gimppalette-import.c
 * app/display/gimpdisplay-handlers.c
 * app/display/gimpdisplayshell-render.c
 * app/display/gimpdisplayshell.c
 * app/gui/info-window.c
 * app/tools/gimpbucketfilltool.c
 * app/tools/gimpbycolorselecttool.c
 * app/tools/gimpclonetool.c
 * app/tools/gimpcolortool.c
 * app/tools/gimpeditselectiontool.c
 * app/tools/gimpfliptool.c
 * app/tools/gimpimagemaptool.c
 * app/tools/gimpiscissorstool.c
 * app/tools/gimppainttool.c
 * app/tools/gimpselectiontool.c
 * app/tools/gimptransformtool.c
 * app/widgets/gimpselectioneditor.c: changed accordingly.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated.

 * libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new().

 * plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog.

 * plug-ins/Lighting/Makefile.am
 * plug-ins/Lighting/*.xpm: removed XPM files...

 * configure.in
 * plug-ins/Lighting/images: ... and added them as PNG images here.
 These should be redone with antialiased edges.

 * plug-ins/Lighting/lighting_stock.[ch]
 * plug-ins/Lighting/lighting_ui.c: register stock icons and use
 those instead of GimpPixmaps.

 * plug-ins/MapObject/Makefile.am
 * plug-ins/MapObject/*.xpm: removed duplicated XPM files.

 * plug-ins/MapObject/mapobject_stock.[ch]: register stock icons
 reusing the generated header from the Lighting plug-in.

 * plug-ins/MapObject/mapobject_ui.c: use them.

 * plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until
 GimpPixmap has been replaced here as well.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist
 will delete global presets if the user running GIMP has priviliges to
 do so). This was done by creating a function to check if a preset is
 global, and by making sure the delete button is in-sensitive when
 this is the case.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorbutton.c
 * libgimpwidgets/gimpcolornotebook.c
 * libgimpwidgets/gimpcolorscale.c
 * libgimpwidgets/gimpcolorscales.c
 * libgimpwidgets/gimpcolorselect.c
 * libgimpwidgets/gimpcolorselection.c
 * libgimpwidgets/gimpframe.c
 * libgimpwidgets/gimppickbutton.c
 * libgimpwidgets/gimpunitmenu.c: some code review and cosmetics.

2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's
 identifiers (= variable names and function name)

2004-07-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL
 string values.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c: override the output_message error
 handler in order to propagate warnings to the user interface
 (related to bug #145212).

2004-07-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimp-utils.[ch]: added new function
 gimp_g_value_get_memsize() that attempts to calculate the memory
 requirements for a GValue.

 * app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the
 new function to obtain a better estimate for the size of the text
 undo.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
 a tiny memory leak.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimpimage-undo.c: resurrected some bit-rotting debug
 code. Might become useful one day.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * autogen.sh: when automake 1.8 is being used, require at least
 version 1.8.3. Earlier versions of the automake-1.8 series don't
 handle gimp-console correctly.

2004-07-13  Michael Natterer  <mitch@gimp.org>

 * app/config/gimpconfig-dump.c
 * app/display/gimpdisplayshell-title.c
 (gimp_display_shell_format_title): applied patch from Dave Neary
 which adds %B which expands to (modified) if the image is
 dirty. Also added %A which expands to (clean) because we also have
 a short indicator for the clean image. Fixes bug #130943.

2004-07-13  Sven Neumann  <sven@gimp.org>

 * app/Makefile.am: removed hack for gimp-console compilation.
 automake seems to handle it correctly all by itself.

2004-07-12  Michael Schumacher <schumaml@cvs.gnome.org>

 * app/app_procs.c: added
 #ifdef G_OS_WIN32
 #include <windows.h>
 #endif

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpbufferview.[ch]: added a preview of the global
 buffer.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * app/Makefile.am: make sure that gimp-console is enabled for
 'make dist'. Use it to dump the system gimprc and gimprc man-page.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/text/gimptextundo.[ch]: removed member "guint time"...

 * app/core/gimpundo.[ch]: ...and added it here.

 * app/tools/gimptexttool.c (gimp_text_tool_apply): changed
 accordingly. Reordered undo compression code to look like other
 pieces of code which do undo compression.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpundo.[ch]
 * app/core/gimpitemundo.[ch]
 * app/text/gimptextundo.[ch]: removed all _new() functions and
 added properties and GObject::constructor() implementations
 instead.

 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
 "GType undo_gtype" parameter and allow to pass name-value pairs as
 "...". Use the new GParameter utility functions to construct the
 appropriate undo step with g_object_newv().

 (gimp_image_undo_push_item): removed.

 (gimp_image_undo_push_undo): removed. Merged its code back into
 gimp_image_undo_push(), where it originally came from.

 * app/core/gimpimage-undo-push.c
 * app/core/gimpundostack.c
 * app/paint/gimppaintcore-undo.c
 * app/tools/gimptransformtool-undo.c
 * app/widgets/gimpundoeditor.c: changed accordingly.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-preview.c
 * plug-ins/gfig/gfig-style.c
 * plug-ins/gfig/gfig.c: some include cleanups. Use
 libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely.
 Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * plug-ins/script-fu/scripts/round-corners.scm: applied patch from
 Dave Neary that changes the behavior from undo disable/enable to
 using an undo group if the script doesn't work on a copy of the
 image. Fixes bug #146344.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * menus/toolbox-menu.xml.in: applied patch from Brion Vibber
 which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-modules.c: don't do anything if gimp->no_interface
 is TRUE.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 Made the gimp-console binary compile.
 Finishes core/GUI separation and fixes bug #71514:

 * configure.in: removed the crazy-hacker warning for
 --enable-gimp-console.

 * app/Makefile.am: for gimp-console, copy app_procs.c to
 app_procs_console.c and compile it instead of app_procs.c with
 -DGIMP_CONSOLE_COMPILATION

 * app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION
 to skip GUI stuff for the gimp-console case.
 Renamed app_gui_libs_init() to app_libs_init(), renamed
 app_gui_abort() to app_abort() and added app_exit() so everything
 that needs #ifdefs lives here now.

 * app/main.c: changed accordingly.

 * app/gui/gui.c (gui_abort): really abort (call exit()).

2004-07-12  Sven Neumann  <sven@gimp.org>

 * INSTALL: made the suggestion to use binary packages more
 prominent, mention --enable-gimp-console.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * app/sanity.[ch]: removed the gtk+ sanity check here ...

 * app/gui/gui.c: ... and do it here from gui_libs_init().

 * app/main.c: changed accordingly.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run
 our own main-loop like we already used to do when being run
 non-interactively.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdialogfactory.c
 (gimp_dialog_factories_set_busy_foreach)
 (gimp_dialog_factories_unset_busy_foreach): set/unset the busy
 cursor on all windows which have widget->window, not only for
 those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
 dialogs are hidden while the busy cursor is active and later shown
 again.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
 property. Some minor cleanup.

2004-07-12  Michael Natterer  <mitch@gimp.org>

 * app/core/Makefile.am
 * app/core/gimp-gui.[ch]: new files defining a GimpGui vtable
 struct and contianing all the vtable wrapper functions. Reordered
 and renamed some functions for consistency.

 * app/core/gimp.[ch]: removed all the vtable code.

 * app/gui/gui-vtable.c: changed accordingly.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplay-foreach.c
 (gimp_displays_get_dirty_images): remove images from the
 container when they become clean. Should move to the Gimp object.

 * app/gui/quit-dialog.c: some cosmetic changes.

2004-07-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tiff.c: applied a patch from Brion Vibber that
 sets the 'Save color values from transparent pixels' insensitive
 when there's no alpha channel.

2004-07-11  Hans Breuer  <hans@breuer.org>

 * **/makefile.msc : updated
   app/actions/makefile.msc app/menus/makefile.msc : (new files)
   app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

 * libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
   app/widgets/gimppropwidgets.c : bumped compiler version check,
 msvc6 still can't cast from unsigned __int64 to double

 * app/actions/debug-actions.c : only use debug_*_callback
 and thus debug_action if ENABLE_DEBUG_MENU

 * app/core/gimpalette-import.c : added gimpwin32-io.h

 * plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

 * plug-ins/common/screenshot.c : make it compile with msvc,
 but still no win32 specific implementation ...

2004-07-11  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig-dobject.h: fix commit error that
 broke build.

2004-07-11  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig-dialog.c
 * plug-ins/gfig/gfig-dobject.[ch]
 * plug-ins/gfig/gfig.c: added buttons to select an object, and
 raise or lower the selected object; also a few minor cleanups.

2004-07-11  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a
 patch from Robert Ögren, moved here from toolbox_check_device().
 Only change devices if the event came from a widget that accepts
 extension events. Fixes bug #115774.

2004-07-11  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-utils.[ch] (gimp_parameters_append)
 (gimp_parameters_append_valist)
 (gimp_parameters_free): new utility functions which create and
 destroy GParameter arrays for g_object_newv().

 * app/gui/gui-vtable.c (gui_pdb_dialog_new): use them.

2004-07-10  Michael Natterer  <mitch@gimp.org>

 Removed any remaining GUI dependency from the PDB wrappers:

 * app/core/gimp.[ch]: added vtable entries for the display and
 help stuff.

 * app/widgets/gimphelp.[ch]: renamed gimp_help() to
 gimp_help_show().

 * app/gui/gui-vtable.c: implement the new display and help vtable
 entries.

 * tools/pdbgen/pdb.pl
 * tools/pdbgen/pdb/display.pdb
 * tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
 object instead of using stuff from display/ and widgets/.

 * tools/pdbgen/app.pl: removed bad hacks which enabled including
 stuff from gui/, display/ and widgets/.

 * app/Makefile.am: link widgets-enums.o, display-enums.o and
 gimpdisplayoptions.o into the gimp-console binary because they are
 needed for the config system and don't depend on any GUI stuff.

 * app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/

 * app/pdb/display_cmds.c
 * app/pdb/help_cmds.c: regenerated.

2004-07-10  Sven Neumann  <sven@gimp.org>

 * app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap.

2004-07-10  Sven Neumann  <sven@gimp.org>

 * app/display/gimpdisplay-foreach.[ch]: added new function
 gimp_displays_get_dirty_images().

 * app/gui/quit-dialog.c: show a container treeview of all dirty
 images in the quit dialog. Still work in progress...

2004-07-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * gimp/plug-ins/gfig/gfig-circle.c
 * gimp/plug-ins/gfig/gfig-dialog.c
 * gimp/plug-ins/gfig/gfig-dobject.c
 * gimp/plug-ins/gfig/gfig-ellipse.c
 * gimp/plug-ins/gfig/gfig-poly.c
 * gimp/plug-ins/gfig/gfig-preview.c
 * gimp/plug-ins/gfig/gfig-star.c
 * gimp/plug-ins/gfig/gfig-style.c
 * gimp/plug-ins/gfig/gfig-style.h
 * gimp/plug-ins/gfig/gfig.c
 * gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for
 fillable objects; other miscellaneous cleanups and minor fixes.

2004-07-09  Sven Neumann  <sven@gimp.org>

 * app/gui/gui.c: removed the quit dialog code here.

 * app/gui/Makefile.am
 * app/gui/quit-dialog.[ch]: added new files that hold the old code
 for now.

2004-07-09  Michael Natterer  <mitch@gimp.org>

 * app/pdb/procedural_db.c: #include <glib-object.h> instead of
 <gtk/gtk.h>.

2004-07-09  Michael Natterer  <mitch@gimp.org>

 * app/gui/Makefile.am
 * app/gui/brush-select.[ch]
 * app/gui/font-select.[ch]
 * app/gui/gradient-select.[ch]
 * app/gui/palette-select.[ch]
 * app/gui/pattern-select.[ch]: removed...

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimppdbdialog.[ch]
 * app/widgets/gimpdataselect.[ch]
 * app/widgets/gimpbrushselect.[ch]
 * app/widgets/gimpgradientselect.[ch]
 * app/widgets/gimppaletteselect.[ch]
 * app/widgets/gimppatternselect.[ch]
 * app/widgets/gimpfontselect.[ch]: ...and added here as a
 hierarchy of widgets.

 * app/widgets/gimpdatafactoryview.h: removed typdef
 GimpDataEditFunc, it's in widgets-types.h now.

 * app/gui/convert-dialog.c: changed accordingly.

 * app/core/gimp.[ch]: added vtable entries for creating, closing
 and setting PDB dialogs.

 * app/gui/gui-vtable.c: implement the vtable entries using the new
 widgets.

 * tools/pdbgen/pdb/brush_select.pdb
 * tools/pdbgen/pdb/font_select.pdb
 * tools/pdbgen/pdb/gradient_select.pdb
 * tools/pdbgen/pdb/palette_select.pdb
 * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
 the Gimp object to create / manage the selection dialogs. The
 generated files don't depend on GUI stuff any longer.

 * app/pdb/brush_select_cmds.c
 * app/pdb/font_select_cmds.c
 * app/pdb/gradient_select_cmds.c
 * app/pdb/palette_select_cmds.c
 * app/pdb/pattern_select_cmds.c: regenerated.

2004-07-09  Sven Neumann  <sven@gimp.org>

 * app/gui/file-save-dialog.c (file_save_overwrite): improved text
 of the dialog.

2004-07-09  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document
 that "help-func" and "help-id" properties have been added for 2.2.

2004-07-09  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphistogrameditor.c
 (gimp_histogram_editor_menu_update): reverted my last change.
 (gimp_histogram_editor_item_visible): fix the problem here instead.

2004-07-08  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpdialog.c: removed "role" property because
 GtkWindow has an equivalent property now. Added "help-func" and
 "help-id" construct properties.

 * app/widgets/gimptexteditor.c
 * app/widgets/gimptooldialog.c
 * app/widgets/gimpviewabledialog.c: removed calls to
 gimp_help_connect() and pass help_func and help_id to
 g_object_new().

2004-07-08  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in
 API docs.

2004-07-08  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist/Presets: converted the newlines in the
 descriptions to whitespaces, so they'll simply wrap (in accordance
 with making the description label wrappable).

2004-07-08  Shlomi Fish  <shlomif@iglu.org.il>

 * plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most
 remaining non-static global variables static, and created functions
 that manipulate them. Created new headers. Renamed some variables and
 functions to make their names more menanigful.

2004-07-08  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphistogrameditor.c
 (gimp_histogram_editor_menu_update): set the active item of the
 combo-box after changing the visibility filter.

2004-07-08  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
 same fix as below.

2004-07-08  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
 block gimp_prop_enum_combo_box_callback() before changing the
 combo-box.

2004-07-08  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpsessioninfo.c: only write aux-info for properties
 that have been changed from their default values.

 * app/widgets/gimphistogrameditor.c: some code cleanup.

2004-07-08  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
 parameter to gimp_selection_data_set_pixbuf() which selects the
 format in which to encode the pixbuf (was defaulting to "png"
 before).

 * app/widgets/gimpclipboard.c: when copying, offer all formats which
 are savable with GdkPixbuf. Added a GimpClipboard struct which is
 attached to the Gimp and which stores all the persistent data
 needed by the clipboard. Renamed some private functions.

 (unfortunately this change breaks pasting to AbiWord:
  http://bugzilla.abisource.com/show_bug.cgi?id=7068)

2004-07-08  Sven Neumann  <sven@gimp.org>
 * app/config/gimpconfig-deserialize.c
 * app/config/gimpconfig-serialize.c: removed redundant casts.

 * app/widgets/gimpsessioninfo.[ch]: added convenience functions to
 get and set aux-info based on object properties.

 * app/widgets/gimphistogrameditor.c: use the new functions to save
 a histogram's channel and scale in the sessionrc.

2004-07-07  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
 that PNG is the preferred format and GIF and JPEG come last.

2004-07-07  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/*.[ch]: Use single centralized functions to
 create, load, and save objects, instead of separate functions
 for each type of object. A few other miscellaneous fixes.

2004-07-07  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpclipboard.[ch]: changed to allow pasting any
 GdkPixbuf supported format (makes pasting from OpenOffice
 work). Cleaned up a bit to perpare pasting of SVG data.

2004-07-07  Sven Neumann  <sven@gimp.org>

 * app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha
 channel if the src tile-manager doesn't have one. Warn on
 unsupported type conversions instead of silently doing the wrong
 thing. Fixes bug #145482.

 * app/core/gimpbuffer.c: cosmetics.

2004-07-07  Michael Natterer  <mitch@gimp.org>

 * app/gui/Makefile.am
 * app/gui/clipboard.[ch]: removed...

 * app/widgets/Makefile.am
 * app/widgets/gimpclipboard.[ch]: ...and added here.

 * app/actions/edit-commands.c
 * app/gui/gui.c: changed accordingly.

2004-07-07  Michael Natterer  <mitch@gimp.org>

 Made the undo system robust against the currently pushed undo
 being too large according to prefs settings. Fixes bug #145379.

 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo)
 (gimp_image_undo_group_end): emit "undo-event" *before* calling
 gimp_image_undo_free_space() so the undo history doesn't try to
 remove an item that has never been added.

 (gimp_image_undo_push_undo): added boolean return value indicating
 if the undo could be pushed (FALSE means the undo was to large
 and was discarded right away).

 (gimp_image_undo_push_item): return NULL if the above returned
 FALSE.

 * app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
 changed accordingly.

2004-07-07  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings
 happened, cause that likely means corruption and libexif doesn't
 handle that very happily. Addresses bug #145212. Perhaps the error and
 warning messages should be propagated to the user in the GUI somehow,
 currently they are not.

2004-07-07  Michael Natterer  <mitch@gimp.org>

 * app/actions/edit-actions.c (edit_actions): added "..." to "Clear
 undo history" because it has a confirmation dialog.

 * app/actions/edit-commands.c: cleanup: moved static functions to
 the end of the file and prototyped them.

2004-07-07  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
 fixed a drawing bug I introduced earlier today.

2004-07-07  Michael Natterer  <mitch@gimp.org>

 * app/actions/view-actions.c
 * app/actions/view-commands.[ch]: added actions and callbacks for
 scrolling the view. Not used in menus but useful for controllers.

2004-07-07  Sven Neumann  <sven@gimp.org>

 * app/tools/gimpeditselectiontool.c
 (gimp_edit_selection_tool_key_press): adapt the arrow key velocity
 to the display scale factor. Please test and complain if you
 dislike this behaviour.

 * themes/Default/images/Makefile.am
 * themes/Default/images/stock-color-pick-from-screen-16.png: new
 icon drawn by Jimmac.

 * libgimpwidgets/gimpstock.[ch]: register the new icon.

 * libgimpwidgets/gimppickbutton.c: use it for the screen color
 picker instead of reusing the color picker tool icon.

2004-07-06  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/*.[ch]:  a bunch of code clean-up and
 debugging.  Created "classes" for the objects, and
 attached functions to classes rather than objects.

2004-07-06  Sven Neumann  <sven@gimp.org>

 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
 bug #145401.

 * app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
 it to the PDB.

 * app/base/gimphistogram.c: implemented histogram functions for
 the RGB mode.

 * app/base/levels.c
 * app/tools/gimpcurvestool.c
 * app/tools/gimplevelstool.c
 * app/widgets/gimpcolorbar.c
 * app/widgets/gimphistogrameditor.c: handle the new enum value.

 * app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
 draw a histogram that shows the RGB channels simultaneously

2004-07-06  Sven Neumann  <sven@gimp.org>

 * libgimpmodule/gimpmodule.c: comply with C99 aliasing rules.

2004-07-06  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpwidgets-utils.c (gimp_menu_position)
 (gimp_button_menu_position): call gtk_menu_set_monitor() only
 for GTK+ < 2.4.4 and added a #warning about it.

2004-07-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/gimpressionist: applied patch from Shlomi Fish that
 fixes confusion of filenames and user-visible object names (bug
 #132621). Also removed function remove_trailing_whitespace() that
 used to duplicate functionality from GLib and updated
 preset_create_filename().

2004-07-06  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppreviewrenderer.c
 (gimp_preview_renderer_set_viewable): queue an idle update when
 setting the viewable to NULL so the view gets cleared correctly.

 (gimp_preview_renderer_idle_update): call
 gimp_preview_renderer_update() even if renderer->viewable is NULL
 so clearing the viewable gets propagated to the GUI.

 Moved clearing the viewable and removing the idle from
 GObject::finalize() to GObject::dispose() because calling
 set_viewable() with a NULL viewable triggers typechecking casts
 and queuing idle functions, which is not nice in finalize().

2004-07-06  Sven Neumann  <sven@gimp.org>

 * modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back
 $(LCMS_LIBS) that I had accidentally removed.

2004-07-06  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
 return the proper type.

2004-07-06  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainertreeview.c: connect to
 "editing-canceled" of the name cell renderer and restore the
 original text in the callback. Doesn't work reliably until GTK+
 bug #145463 is fixed.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a
 compiler warning.

 * plug-ins/common/dog.c: removed some redundant casts and other
 trivial cleanups.

2004-07-06  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.h: removed #define
 GIMP_CONTROLLER_PARAM_SERIALIZE.

 * libgimpmodule/gimpmoduletypes.h: added
 GIMP_MODULE_PARAM_SERIALIZE instead.

 * modules/controller_linux_input.c
 * modules/controller_midi.c: changed accordingly.

 * modules/cdisplay_colorblind.c
 * modules/cdisplay_gamma.c
 * modules/cdisplay_highcontrast.c
 * modules/cdisplay_proof.c: made the new properties serializable.

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * tools/pdbgen/Makefile.am (enum_headers): don't scan
 app/paint-funcs/paint-funcs-types.h for enums.

 * app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/

 * app/core/core-types.h: reordered opaque typedefs to somehow
 match the categories in the comments.

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * app/core/core-types.h: removed enum SizeType.

 * app/text/text-enums.h: added it as enum GimpSizeType and added
 comment that it's for backward compatibility only.

 * tools/pdbgen/Makefile.am
 * tools/pdbgen/pdb/text_tool.pdb: changed accordingly.

 * libgimp/gimpenums.h
 * plug-ins/pygimp/gimpenums.py
 * plug-ins/script-fu/script-fu-constants.c
 * tools/pdbgen/enums.pl: regenerated (pdbgen insisted on
 reordering the enums).

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * app/core/core-types.h: #define MIN and MAX values for
 GimpCoords.pressure, .tilt and .wheel.

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_get_event_coords)
 (gimp_display_shell_get_device_coords): use the #defines instead
 of hardcoded magic values when CLAMP()ing event or device values.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * modules/Makefile.am: link all modules with libgimpmodule.

2004-07-05  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/dog.c: improved defaults.  use gimp_invert()
 instead of rolling own.  Use nasty hack to get previews to
 work with grayscale images.  Accept grayscale images.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the
 basename parameter and use the object name instead. Convert it to
 the filesystem encoding.

 * app/core/gimpdatafactory.c: changed accordingly.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/gimpressionist: applied patch from Shlomi Fish that
 fixes a number of bugs in the gimpressionst plug-in (bug #145309).

 Also added some const qualifiers, cleaned up includes and removed
 degtorad() and radtodeg() functions that used to duplicate
 functionality from libgimpmath.

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimptemplateview.c
 (gimp_template_view_tree_name_edited): removed unused local variables.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an
 object. Removed trailing whitespace.

 * plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration.

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
 return TRUE if initialization was successful. Makes the
 tool->drawable pointer being set correctly by the calling code and
 fixes bugs where colorize was leaving the drawable in a modified
 but non-undoable state when cancelling or changing images.

2004-07-05  Sven Neumann  <sven@gimp.org>

 * modules/cdisplay_proof.c: use object properties for the
 configurable values.

2004-07-05  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpchannel.[ch]: added signal "color-changed" and emit
 it in gimp_channel_set_color() and gimp_channel_set_opacity().

 * app/core/gimpimage-qmask.[ch]: added new functions
 gimp_image_set,get_qmask_color().

 * app/core/gimpimage.[ch]: install a "color-changed" handler on
 gimage->channels and update gimage->qmask_color when the qmask's
 color changes. Fixes bug #145361.

 * app/actions/qmask-commands.c: use the new qmask color API.

2004-07-04  Simon Budig  <simon@gimp.org>

 * app/actions/dialogs-commands.c
 * app/display/gimpdisplayshell-dnd.c
 * app/gui/preferences-dialog.c
 * app/tools/gimppainttool.c
 * app/widgets/gimpdeviceinfo.c
 * app/widgets/gimpitemtreeview.c
 * plug-ins/imagemap/imap_selection.c
 * tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
 CVS compile with gcc 2.95 again. Mostly double semicolons and
 variable declarations after other stuff. Spotted by Martin
 Renold.

 * app/pdb/gradients_cmds.c: regenerated.

 (there is one issue left, see his patch at
 http://old.homeip.net/martin/gcc-2.95.diff, I did not
 copy the #define va_copy __va_copy, since I don't know
 what happens here.)

2004-07-04  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig-dialog.[ch]:
 * plug-ins/gfig/gfig-style.[ch]:
 * plug-ins/gfig/notes.txt:       New files.
 * plug-ins/gfig/*.[ch]:  Complete reworking of the gfig plug-in.
 See 'notes.txt' for a summary of what has changed, and how to use
 it now.  Plenty of bugs have been  introduced, which will take a
 while to straighten out.

2004-07-04  Tor Lillqvist  <tml@iki.fi>

 * app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop
 a couple of unused variables.

 * libgimpmodule/gimpmodule.def: Add gimp_module_register_enum.

2004-07-04  Sven Neumann  <sven@gimp.org>

 * libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(),
 a function to register an enum type for a GTypeModule.

 * modules/cdisplay_colorblind.c: use an object property for the
 color deficiency enum.

2004-07-04  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/channel_mixer.c: don't attempt to store a
 pointer to the last used filename in the plug-in parameter
 struct. Fixes bug #145380.

2004-07-04  Sven Neumann  <sven@gimp.org>

 * modules/cdisplay_gamma.c
 * modules/cdisplay_highcontrast.c: added object properties for
 configurable values.

 * app/widgets/gimpcolordisplayeditor.c
 * libgimpwidgets/gimpcolordisplaystack.c
 * modules/cdisplay_colorblind.c
 * modules/cdisplay_proof.c: cosmetic changes.

2004-07-03  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpcontext.[ch]: added context->serialize_props mask
 which enables specifying exactly which properties will be
 serialized. Also fixes a bug that prevented undefined properties
 from being serialized, breaking tool_options and device status
 serialization.

 * app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
 properties in the tool_info->context_props mask serializable, also
 configure/initialize tool_info->tool_options.

 * app/tools/gimp-tools.c (gimp_tools_register): removed
 tool_options initialization that is now done in
 gimp_tool_info_new().

 * app/widgets/gimpdeviceinfo.c: make only the properties in
 GIMP_DEVICE_INFO_CONTEXT_MASK serializable.

 * app/widgets/gimpdevicestatus.c: add the device table to its
 parent container again. Fixes "missing" devices.

 * app/core/gimptooloptions.c
 * app/widgets/gimpdevices.c: cleanup / code review.

2004-07-03  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
 the color tool is enabled, skip cursor hiding entirely.

2004-07-03  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't
 any longer needed.

2004-07-02  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformoptions.[ch]:
 * app/tools/gimptransformtool.c:
 * app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
 a combobox with options "Outline", "Grid", "Image", and
 "Image + Grid". Addresses bug #108172.

2004-07-02  Sven Neumann  <sven@gimp.org>

 * app/actions/edit-actions.c: don't let the Paste menu items
 sensitivity depend on the availability of clipboard data because
 we aren't notified when the GDK clipboard changes.

2004-07-02  Sven Neumann  <sven@gimp.org>

 * app/gui/Makefile.am
 * app/gui/clipboard.[ch]: new files implementing a clipboard for
 image data based on GDK_SELECTION_CLIPBOARD (bug #133247).

 * app/actions/edit-actions.c
 * app/actions/edit-commands.c: use the new clipboard API.

 * app/gui/gui.c: initialize and shutdown the clipboard.

 * app/core/gimpbuffer.c: cosmetics.

 * app/actions/actions.c
 * app/menus/menus.c: added sanity checks to exit functions.

 * app/display/gimpdisplayshell-dnd.[ch]: let
 gimp_display_shell_drop_svg() take a guchar * buffer.

 * app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
 fixed the implementation.

2004-07-02  Michael Natterer  <mitch@gimp.org>

 * plug-ins/gimpressionist/Makefile.am
 * plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish
 that massively cleans up gimppressionist (touching all files and
 addding some new ones) and adds a simple PDB interface for
 selecting one of the previously created presets.
 Fixes bugs #145191, #144913 and #144922.

2004-07-01  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version number to 2.1.2.

2004-07-01  Michael Schumacher  <schumaml@cvs.gnome.org>

 * plug-ins/common/align_layers.c: there seems to be no reason why
 this plug-in should not work on INDEXED* images, added it to the
 registered image types

2004-07-01  Roman Joost <roman@bromeco.de>

 * plug-ins/script-fu/scripts/blend-anim.scm
 * plug-ins/script-fu/scripts/glossy.scm
 * plug-ins/script-fu/scripts/test-sphere.scm: fixed typos

2004-07-01  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
 gimp_selection_data_[get|set]_pixbuf().

2004-07-01  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
 and set the FG/BG depending on where the color was dropped. Also
 set the drag status accordingly so the cursor indicates whether
 dropping will have an effect or not. Fixes bug #145219.

2004-07-01  Sven Neumann  <sven@gimp.org>

 * app/core/gimptemplate.c: do like Liam taught us and use the
 golden ratio as default for new images.

2004-06-30  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
 Chain up if the color tool is enabled. This fixes the problem of
 the color picker cursor not appearing when using a paint tool
 in color picking mode while "Show Paint Tool Cursor" is off.

2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * libgimp/gimpdrawable.c: moved call to
 _gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to
 gimp_drawable_flush(), to resolve problem described in bug
 #145051.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 * app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext
 parameter and use it to start plug-ins.

 * app/core/gimp.c (gimp_real_restore): pass the user context.
 Restores script-fu's access to the global FG, FG, brush, ...

2004-06-30  Sven Neumann  <sven@gimp.org>

 * app/core/core-enums.c
 * app/display/display-enums.c
 * app/paint/paint-enums.c
 * app/text/text-enums.c
 * app/widgets/widgets-enums.c: regenerated.

2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/actions/file-commands.c: revert previous change that was
 intended to fix bug #141971.

2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/*/*-enums.h: did HIG-compliant capitalization in the right
 place, instead of the auto-generated *-enums.c files.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdnd.[ch]
 * app/widgets/gimpselectiondata.[ch]
 * app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
 to "uri_list" in all function names, parameters and typedefs.

 * app/widgets/gimpcontainertreeview-dnd.c
 * app/widgets/gimpdocumentview.c
 * app/widgets/gimplayertreeview.c
 * app/widgets/gimptoolbox-dnd.c
 * app/display/gimpdisplayshell-dnd.[ch]
 * app/display/gimpdisplayshell.c: changed accordingly.

2004-06-30  Sven Neumann  <sven@gimp.org>

 * plug-ins/maze/maze_face.c: made the dialog look a little less
 clumsy.

2004-06-30  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/drawable.pdb
 * libgimp/gimppixbuf.c: raised the maximum size for thumbnails
 from 256 to 512 pixels.

 * app/pdb/drawable_cmds.c
 * libgimp/gimpdrawable_pdb.c: regenerated.

 * plug-ins/gfig/gfig-preview.c
 * plug-ins/gfig/gfig.c: redone Bill's fix using
 gimp_image_get_thumbnail(). A lot simpler, renders the alpha
 checkerboard and also works for grayscale images.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 Fixed a 1.2 -> 2.0 regression that was forgotten:

 * app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
 which can be one of { NEW, UPDATE }.

 * app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
 gimp_palette_editor_update_color() to
 gimp_palette_editor_pick_color() and restored the functionality of
 creating/updating colors via this API

 Changed button_press handler to only edit the color on double
 click if it's really a double click on the same color.
 Fixes bug #141381.

 * app/tools/gimpcolorpickeroptions.[ch]: added boolean property
 "add-to-palette" and a GUI for it.

 * app/core/gimpmarshal.list
 * app/tools/gimpcolortool.[ch]: added a GimpColorPickState
 parameter to the "color_picked" signal. Pass NEW on button_press
 and UPDATE on motion.

 * app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
 * app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
 * app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
 changed accordingly

 * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
 If "add-to-palette" is TRUE, get the palette editor and call
 gimp_palette_editor_pick_color().

2004-06-30  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpselectiondata.[ch]: renamed the SVG related
 functions so that they deal with an anonymous data stream that
 could as well be a PNG image.

 * app/widgets/gimpdnd.[ch]
 * app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.

 * app/display/gimpdisplayshell-dnd.[ch]
 * app/vectors/gimpvectors-import.[ch]
 * app/widgets/gimpcontainertreeview-dnd.c
 * app/widgets/gimpvectorstreeview.c: use gsize for the length of
 the buffer.

 * app/widgets/gimpdnd.[ch]
 * app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
 used yet.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 * app/core/gimppalette.[ch] (gimp_palette_add_entry): take
 const GimpRGB* instead of just GimpRGB*.
 Converted tabs to spaces.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 * widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
 changed return value from gchar* to const gchar*. Renamed
 parameters to be consistent with other SVG functions.

 * widgets/gimpcontainertreeview-dnd.c
 * widgets/gimpdnd.c: changed accordingly.

2004-06-30  Simon Budig  <simon@gimp.org>

 * app/vectors/gimpstroke.[ch]
 * tools/pdbgen/pdb/paths.pdb: Applied a modified patch from
 Geert Jordaens that implements the gimp-path-get-point-at-dist
 PDB function (fixes bug #138754).

 * app/pdb/paths_cmds.c: regenerated.

2004-06-30  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
 do like GtkAccelLabel does and turn underscores in accels into
 spaces so e.g. "Page_Up" becomes "Page Up".

2004-06-29  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c: reordered drop destinations
 so vectors are preferred over SVG.

 * app/vectors/gimpvectors-import.[ch]: added "gint position"
 parameter to all import functions so the imported vectors can be
 added at any position in the vectors stack.

 * app/actions/vectors-commands.c
 * app/display/gimpdisplayshell-dnd.c
 * tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
 position).

 * app/pdb/paths_cmds.c: regenerated.

 * app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
 to the paths dialog.

2004-06-29  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
 after dropping, it's owned by GtkSelectionData.

2004-06-29  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
 gtk_target_list_add_table() because the latter prepends the
 targets to the internal list which screws the order (== priority)
 of DND targets.

 * app/widgets/gimpselectiondata.c: added some more checks for
 failed drops (selection_data->length < 0).

2004-06-29  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/unsharp.c: The preview's row buffer was
 accidentally made way too large.

2004-06-29  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpwidgets-utils.[ch]: added new function
 gimp_get_mod_string() which takes a GdkModifierType and returns
 correctly formated strings for all shift,control,alt combinations.

 * app/tools/gimpbucketfilloptions.c
 * app/tools/gimpcolorpickeroptions.c
 * app/tools/gimpconvolvetool.c
 * app/tools/gimpcropoptions.c
 * app/tools/gimpdodgeburntool.c
 * app/tools/gimperasertool.c
 * app/tools/gimpflipoptions.c
 * app/tools/gimpmagnifyoptions.c
 * app/tools/gimpmoveoptions.c
 * app/tools/gimptransformoptions.c
 * app/tools/gimpvectoroptions.c
 * app/widgets/gimpchanneltreeview.c
 * app/widgets/gimpcolormapeditor.c
 * app/widgets/gimpdocumentview.c
 * app/widgets/gimperrorconsole.c
 * app/widgets/gimpgradienteditor.c
 * app/widgets/gimpitemtreeview.c
 * app/widgets/gimppaletteeditor.c
 * app/widgets/gimpselectioneditor.c
 * app/widgets/gimpthumbbox.c
 * app/widgets/gimptooloptionseditor.c
 * app/widgets/gimpvectorstreeview.c: use the new function instead
 of gimp_get_mod_name_shift(),control(),alt(),separator(). This
 kindof addresses the issue of configurable modifier keys but is
 actually indended to ease translation of format strings ("%s" is
 easier to get right than "%s%s%s").

2004-06-28  Michael Natterer  <mitch@gimp.org>

 Allow all sorts of things to be dropped on or in between the
 items of a GimpContainerTreeView:

 * app/widgets/gimpcontainertreeview.[ch]: added more parameters to
 GimpContainerTreeView::drop_possible() to specify where ecactly
 the drop should take place (between or into items) and to support
 dropping all sorts of things.

 Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
 ::drop_files() and ::drop_svg(), which cover all possible drop
 types.

 * app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
 Dispatch all kinds of drops to the resp. virtual functions.

 * app/widgets/gimpitemtreeview.c: changed accordingly.

 * app/widgets/gimplayertreeview.c: allow to drop URIs, colors
 and patterns to the layers dialog. Fixes bugs #119506 and #139246.

2004-06-28  Michael Natterer  <mitch@gimp.org>

 * app/file/file-open.[ch] (file_open_layer): new utility function
 which opens an image, flattens it if needed and returns the only
 layer, converted for a passed destination image.

 * app/display/gimpdisplayshell-dnd.c
 (gimp_display_shell_drop_files): use the new function.

2004-06-28  Michael Natterer  <mitch@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/gimpselectiondata.[ch]: new files containing the
 code which encodes/decodes all sorts of stuff to/from its
 GtkSelectionData representation. Used to live in gimpdnd.c

 * app/widgets/gimpdnd.c: use the new functions (unclutters the
 file quite a bit), converted tabs to spaces.

2004-06-28  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontainergridview.c:
 #include "libgimpwidgets/gimpwidgets.h"

2004-06-28  Michael Natterer  <mitch@gimp.org>

 Fixed bug #141930 while keeping bug #132322 fixed:

 * app/base/curves.c (curves_lut_func)
 * app/base/levels.c (levels_lut_func): changed meaning of channel
 slots for GRAYA images: just as for GRAY images, expect the value
 channel in slot 0 and the alpha channel in slot 1, so it matches
 the meaning of slots of GimpHistogram (before this change, only
 GRAY images had their value in slot 0 and GRAYA images had it in
 slot 1, whereas the histogram had the value channel in slot 0,
 which was breaking auto levels for GRAYA images).

 * app/tools/gimpcurvestool.c
 * app/tools/gimplevelstool.c
 * tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
 and GRAYA images accordingly.

 * app/tools/gimpcurvestool.c (curves_update)
 * app/tools/gimplevelstool.c (levels_update): call
 gimp_color_bar_set_buffers() with the right buffers.

 * app/pdb/color_cmds.c: regenerated.

2004-06-28  Sven Neumann  <sven@gimp.org>

 * app/gui/gui.c (gui_initialize_after_callback): select the
 standard tool.

 * app/tools/tool_manager.c: cosmetics.

2004-06-28  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimplevelstool.c: reverted fix for bug #141930. These
 hacks are there because the enum used in levels doesn't match
 the enum used by the combo box and the histogram widget.

2004-06-28  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
 removed again (tools must not draw outside GimpDrawTool::draw()).

 (gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
 because the draw function would not be called if the draw tool was
 inactive. Simplified check for whether or not to draw the src
 location.

 * app/tools/gimppainttool.c (gimp_paint_tool_button_release):
 pause/resume the draw tool across all button_release actions so
 tools (clone) have a chance to draw different things depending on
 gimp_tool_control_is_active(tool->control). Fixes bug #145022.

2004-06-28  Sven Neumann  <sven@gimp.org>

 * app/actions/actions.c (action_select_object): added missing
 return value.

2004-06-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/dog.c: applied HIG rules to the GUI and slightly
 rearranged it to get a more compact layout. Applied GIMP coding
 style.

2004-06-28  Sven Neumann  <sven@gimp.org>

 * libgimp/gimpdrawable.c: removed wrong note about using
 _gimp_tile_cache_flush_drawable() from the API docs.

2004-06-28  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/dog.c (dog): ifdef'ed out calls to
 _gimp_tile_cache_flush_drawable() since it can't be used from a
 plug-in. Removed trailing whitespace and redundant includes.

 * libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again.

2004-06-28  Simon Budig  <simon@gimp.org>

 * app/tools/gimpvectortool.c: fixed drawing code to properly
 update after deleting nodes via BackSpace/Delete.

2004-06-27  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimplevelstool.c: removed two small chunks of code.
 Fixes bug #141930.  Possibly unfixes bug #132322.

2004-06-27  Michael Schumacher <schumaml@cvs.gnome.org>

 * libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because
 it is used in a plug-in. See bug #145051.

2004-06-26  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/unsharp.c: Preview now works correctly with
 RGBA and grayscale-alpha images. Fixes bug #144971.

2004-06-26  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpclonetool.c: added button_release callback
 to fix bug #145022.

2004-06-26  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source
 is grayscale or grayscale-alpha. Partial fix for bug #144971.

2004-06-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/unsharp.c: speed up preview by allocating tile
 cache before creating dialog.  Should fix bug #144972.

2004-06-25  Philip Lafleur  <plafleur@cvs.gnome.org>

 * plug-ins/common/zealouscrop.c: Moved Zealous Crop from
 <Image>/Layer/Crop to <Image>/Image/Crop because it affects the
 entire image.

2004-06-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/dog.c: added Difference of Gaussians edge
 detect plug-in.

 * plug-ins/common/plugin-defs.pl:
 * plug-ins/common/Makefile.am: added dog and regenerated
 Makefile.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET
 actions which set a generated brush's properties directly.

 * app/actions/context-commands.c: adjust the range of possible
 brush radius and aspect_ratio values to be actually usable.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpbrushgenerated.[ch]: reordered parameters and
 members to be consistent with other places where generated
 brushes are used. Check for errors when loading a brush and
 utf8-validate its name. Cleanup.

 * app/core/gimpbrush.c
 * app/core/gimpbrushpipe.c: cleanup.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/gui/preferences-dialog.c (prefs_dialog_new): work around
 GTK+ bug #143270 (set the cursor on the selected model path
 instead of selecting the iter in the selection). Fixes random
 theme switching when selecting the "Theme" page.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpbrushgenerated.c: added properties for all brush
 parameters.

 * app/widgets/gimpbrusheditor.c: listen to property changes of the
 edited brush and update the scales accordingly.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/gui/preferences-dialog.c: more work on the controller page,
 made integer controller properties editable.

 * modules/controller_midi.c: allow to specify the MIDI channel to
 generate events from. Default to -1 (all channels).

2004-06-24  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/gfig/gfig.[ch]:
 * plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the
 image as background for its preview, if the image is RGB and "Show
 image" is checked in the Options tab.  (Next best thing to
 previewing in the image.)

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
 "debug-events" and honor it when printing debugging output.
 Should add an event console window so the user doesn't need to
 have a terminal to inspect input module output.

 * app/gui/prefereces-dialog.c: HIGified some forgotten labels.
 Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
 Replaced some forgotten "Dir" with "Folder".
 Made more GimpControllerInfo and GimpController properties
 editable and cleaned up the controller page.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().

 * app/widgets/gimpgrideditor.c: HIGified capitalization.

2004-06-25  Michael Natterer  <mitch@gimp.org>

 * modules/controller_linux_input.c
 * modules/controller_midi.c: remember the source ID returned by
 g_io_add_watch() and remove it when changing the device, so the
 file descritor gets actually closed. Minor cleanups.

2004-06-24  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollerwheel.[ch]: renamed function
 gimp_controller_wheel_scrolled() to
 gimp_controller_wheel_scroll().

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_canvas_tool_events): changed accordingly.

2004-06-24  Michael Natterer  <mitch@gimp.org>

 * etc/controllerrc: fix typo in wheel controller mapping.

2004-06-24  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptool.[ch]
 * app/tools/tool_manager.[ch]: added boolean return value to
 GimpTool::key_press() which indicates if the event was handled.

 * app/tools/gimpcroptool.c
 * app/tools/gimpeditselectiontool.[ch]
 * app/tools/gimptransformtool.c
 * app/tools/gimpvectortool.c: return TRUE if the key event was handled.

 * app/tools/gimppainttool.c: removed key_press() implementation.

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
 which takes GdkEventKey and emits controller events for all
 combinations of modifiers and cursor keys.

 * app/widgets/gimpcontrollers.[ch]: added new function
 gimp_controllers_get_keyboard().

 * app/display/gimpdisplayshell-callbacks.c: if a key event was not
 handled by the active tool, dispatch it to the keyboard controller.

 * etc/controllerrc: add a keyboard controller which is configured
 to do the same as the removed gimp_paint_tool_key_press().

2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * libgimp/gimpdrawable.c:  added some documentation for
 a few important functions with no API docs.

2004-06-24  Sven Neumann  <sven@gimp.org>

 * Made 2.1.1 release.

2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/actions/file-commands.c: make "Revert" only ask for
 confirmation if image is dirty.  Fixes bug #141971.

2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/gui/*.c:
 * app/widgets/*.c:
 * etc/templaterc: HIGify capitalization.  Should finish bug #123699
 except for everything I missed or got wrong.

2004-06-24  Sven Neumann  <sven@gimp.org>

 * etc/controllerrc: commented out the linux_input controller
 configuration.

2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/*.c: HIGify capitalization for dialogs.  More
 progress on bug #123699.

2004-06-23  Michael Natterer  <mitch@gimp.org>

 * modules/controller_midi.c: added utility function midi_event()
 which assembles a GimpControllerEventValue and emits it.

2004-06-23  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpenumaction.[ch]
 * app/widgets/gimppluginaction.[ch]
 * app/widgets/gimpstringaction.[ch]: added parameters to the
 gimp_*_action_selected() function so the "selected" signal can be
 emitted with value != action->value. Changed GtkAction::activate()
 implementations accordingly (pass action->value).

 * app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
 and pass the value of the GimpControllerEventValue instead of
 temporarily replacing action->value and calling
 gtk_action_activate().

 * app/widgets/gimpcontrollerinfo.c: fixed debugging output.

2004-06-23  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
 G_SIGNAL_RUN_LAST so we can connect before and after the default
 implementation. Moved the brush setting and outline invalidation
 stuff to its default implementation. Also remember the outline's
 width and height. Call gimp_brush_core_set_brush() from
 gimp_brush_core_invalidate_cache() so "set-brush" is emitted
 whenever a generated brush becomes dirty.

 * app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
 pause/resume but rather stop/start the draw_tool. Fixes straight
 line preview aretefacts.

 (gimp_paint_tool_oper_update): set the brush_core's brush before
 starting the draw_tool.

 (gimp_paint_tool_draw): never free the brush_core's cached brush
 outline because the brush_core does that by itself now.

 (gimp_paint_tool_set_brush)
 (gimp_paint_tool_set_brush_after): new callbacks which pause and
 resume the draw_tool. Fixes brush outline artefacts when modifying
 the current brush e.g. by using the mouse wheel.

2004-06-23  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-commands.h: removed enum GimpContextSelectType.

 * app/actions/actions-types.h: added enum GimpActionSelectType.

 * app/actions/actions.[ch]: added utility functions
 action_select_value() and action_select_object().

 * app/actions/context-actions.c
 * app/actions/context-commands.c: changed accordingly.

 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]: merged the layer select
 callbacks into one using the GimpActionSelectType functions. Added
 actions and callbacks for modifying the active layer's opacity.

 * app/menus/menus-types.h: #incude "actions/action-types.h".

 * app/gui/gui-types.h: #incude "menus/menus-types.h".

 * app/gui/preferences-dialog.c: allow to enable/disable input
 controllers.

2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpcurvestool.c: try again to revert.

2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpcurvestool.c: reverted.

2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/script-fu/scripts: HIG-ified capitalization on
 all.  Finishes this for everything in plug-ins.  Bug #123699 is
 now mostly fixed.

2004-06-22  Sven Neumann  <sven@gimp.org>

 * app/composite/gimp-composite-regression.c: define timersub()
 macro in case it's undefined. Patch by Tim Mooney, fixes 'make
 check' on Tru64 (bug #144780).

2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpcurvestool.c: added Store/Recall buttons for
 one-click saving and loading of curves.  Should create stock
 labels for them.  Hopefully resolves bug #75558.

2004-06-22  Michael Natterer  <mitch@gimp.org>

 * app/actions/view-actions.c
 * app/actions/view-commands.[ch]: added actions & callbacks to
 configure the canvas padding color.

 * app/widgets/gimphelp-ids.h
 * menus/image-menu.xml.in: added the actions' help IDs and menu entries.

 * app/display/display-enums.h: added /*< skip >*/'ed enum value
 GIMP_CANVAS_PADDING_MODE_RESET.

 * app/display/gimpdisplayshell-appearance.c
 * app/display/gimpdisplayshell-callbacks.[ch]
 * app/display/gimpdisplayshell-handlers.c
 * app/display/gimpdisplayshell.[ch]: removed the canvas padding
 button and its popup menu (fixes bug #142996). Instead, added a
 toggle button which allows to zoom the image when the window is
 resized (as known from sodipodi, except it doesn't work as nice
 yet :-) improvements to the algorithm are welcome).
 Cleaned up the GimpDisplayShell struct a bit and renamed some
 of its members.

 * libgimpwidgets/gimpstock.[ch]
 * themes/Default/images/Makefile.am
 * themes/Default/images/stock-zoom-follow-window-12.png: added new
 icon for the new display toggle button.

2004-06-22  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
 unconditionally now that we draw the brush outline while
 painting. Fixes brush outline artefacts on button_press and
 button_release. Spotted by sjburges.

2004-06-22  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
 the filename if the image is unnamed.

 * configure.in
 * app/sanity.c: depend on gtk+ >= 2.4.1.

 * app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
 to gimp_thumb_box_take_uris() since the function takes ownership
 of the list,

 * app/widgets/gimpfiledialog.c: changed accordingly. Removed code
 that worked around a problem in gtk+ < 2.4.1.

2004-06-22  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use
 gimp_rgb_distance() for flat color areas. Fixes bug #144786.

2004-06-22  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a
 generated file, need to do the documentation change here.

 * app/pdb/fileops_cmds.c
 * libgimp/gimpfileops_pdb.c: regenerated.

2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimptransformoptions.c: use radio buttons
 for constraint options.  Makes all options visible,
 should resolve bug #68106.

2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/gui/file-save-dialog.c: to reduce clutter, hide overwrite
 query dialog after user has responded.

2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/noisify.c: changed handling of alpha
 channel in an attempt to deal with bug #72853.
 Changed menu entry from "Noisify" to "Scatter RGB".

2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/pdb/fileops_cmds.c: fixed incorrect documentation for
 gimp_file_load, which was the root cause of bug #118811.

2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins: finish implementing HIG capitalization in dialogs.
 Scripts remain to be done.  More progress on bug #123699.

2004-06-21  Michael Natterer  <mitch@gimp.org>

 * app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
 value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
 of GDK to do that (it was GDK that was broken, not some of the X
 servers).

 * app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
 cursor's pixels for GTK+ < 2.4.4.

2004-06-21  Sven Neumann  <sven@gimp.org>

 * app/gui/gui.c (gui_exit_callback): improved message in quit
 dialog just in case that we don't manage to redo this dialog
 before 2.2.

2004-06-21  Sven Neumann  <sven@gimp.org>

 * libgimpwidgets/gimpwidgets.[ch]
 * libgimpwidgets/gimpwidgets.def: added new utility function
 gimp_label_set_attributes().

 * app/display/gimpdisplayshell.c
 * app/gui/preferences-dialog.c
 * app/gui/resolution-calibrate-dialog.c
 * app/widgets/gimpviewabledialog.c
 * app/widgets/gimpwidgets-utils.c: use the new function.

 * app/widgets/gimpcontainergridview.c
 * app/widgets/gimphistogrameditor.c: display the name in italic.

 * plug-ins/common/jpeg.c: display the file size in italic.

2004-06-20  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/url.c: if url does not end in a recognized
 extension, open it as an unnamed image.  Fixes bug #118811.

2004-06-20  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphistogrambox.[ch]: removed the label between the
 spinbuttons, it looks silly. Converted tabs to spaces, removed
 trailing whitespace.

 * app/widgets/gimphistogrameditor.c
 * app/tools/gimpthresholdtool.c: changed accordingly.

2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins:  changed dialogs to follow HIG capitalization style
 wherever they didn't.  Scripts remain to be done.  Partially
 fixes bug #123699.

2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/widgets/gimphistogrambox.[ch]:
 * app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
 so that it uses a two-triangle-slider scale of the sort used in the
 levels tool.  Almost all of the changes are actually in the
 histogram-box widget code, which is only used by the threshold
 tool.  Fixes bug #137521.

2004-06-20  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/jpeg.c: removed redundant hboxes and other
 layout cleanups.

2004-06-20  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-scale.[ch]:
 * app/display/gimpnavigationview.[ch]:
 * app/actions/view-actions.c:
 * app/actions/view-commands.[ch]:
 * app/widgets/gimphelp-ids.h:
 * menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
 to "Fit Image in Window" and added another command, "Fit Image
 to Window", that zooms according to the opposite dimension. Fixes
 bug #144597.

2004-06-19  Michael Schumacher  <schumaml@cvs.gnome.org>

 * libgimpwidgets/gimpwidgets.def: added missing
 gimp_controller_* entries

2004-06-19  Michael Schumacher  <schumaml@cvs.gnome.org>

 * modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK

2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/jpeg.c: more changes to save dialog.  Moved
 comment field to Advanced area.  Don't set restart marker
 frequency stuff insensitive.  Changed range for quality
 scale from 0-1 to 0-100 to follow the jpeg spec (but left
 allowable range for pdb at 0-1 to avoid breaking anything).

2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
 worked incorrectly for two of the control points.

2004-06-19  Michael Natterer  <mitch@gimp.org>

 * modules/controller_midi.c (midi_read_event): simplified
 swallowing of SysEx messages and unwanted data bytes. Reordered
 and commented stuff to be more readable.

2004-06-19  Michael Natterer  <mitch@gimp.org>

 * modules/Makefile.am
 * modules/controller_midi.c: new controller for MIDI input. Maps
 all note on and note off events and all MIDI controllers to
 GimpContollerEvents. Should parse any MIDI stream. Code based on
 blinkenmedia stuff from Daniel Mack.

2004-06-19  Sven Neumann  <sven@gimp.org>

 Applied a patch from Geert Jordaens that implements the
 GtkStatusbar functionality in GimpStatusbar so that we can redo it
 in order to fix bug #120175:

 * app/core/gimpmarshal.list: added VOID: UINT, STRING.

 * app/display/gimpstatusbar.[ch]: copied GtkStatusbar code.

 * app/display/gimpdisplayshell.c: changed accordingly.

2004-06-19  Sven Neumann  <sven@gimp.org>

 * plug-ins/ifscompose/ifscompose_utils.c (create_brush): use
 G_SQRT2; some coding style cleanups.

2004-06-19  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved
 array initialization out of variable declaration (bug #144632).

2004-06-19  Sven Neumann  <sven@gimp.org>

 * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use
 G_SQRT2 to make circlemagic a constant value so we can initialize
 the array on declaration. Fixes bug #144632.

2004-06-19  Sven Neumann  <sven@gimp.org>

 * devel-docs/parasites.txt: document "exif-data" parasite.

2004-06-18  Manish Singh  <yosh@gimp.org>

 * plug-ins/common/film.c: Don't use deprecated gimp_text functions,
 clean up font name string handling a bit, default is now "Monospace"
 instead of "Courier".

2004-06-19  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
 start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
 Assume the double value is in a [0.0..1.0] range and temporarily
 change the value of the called GimpEnumAction to a range of
 [0..1000] when invoking it. All still very hackish...

2004-06-19  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
 more debugging output.

2004-06-18 Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * app/tools/gimpscaletool.c: changed algorithm for scaling when
 aspect ratio is constrained, to fix strange behavior described
 in bug # 68106.

2004-06-18 Bill Skaggs  <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/jpeg.c:  redid save dialog along lines suggested
 in bug # 138929

 Only create an exif data parasite on loading file if the file actually
 contains exif data.

 Call exif data parasite "exif-data" instead of "jpeg-exif-data",
 because it should be interchangeable with TIFF exif data.

2004-06-18  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c
 * app/actions/context-commands.[ch]: added tons of new actions to
 modify the current FG/BG color's RGB components.

 Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set
 values, not only increase/decrease them.

 Changed context_select_value() utility function to interpret
 GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings
 in a range from 0 to 1000. Yes, that's a hack...

2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformtool.c: reverted my fix to bug #144570.

2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.

2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
 If transforming a path, use the path bounds rather than the mask
 bounds. Fixes bug #144570.

2004-06-17  Michael Natterer  <mitch@gimp.org>

 * app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().

 * app/core/gimp.c
 * app/widgets/gimpcontrollerinfo.c: use it.

2004-06-17  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpcontainer.c (gimp_container_deserialize): add newly
 created children to the container *after* deserializing them so
 GimpContainer::add() callbacks get the already deserialized
 object.

 * app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
 the controller list and remember / clear the wheel controller when
 it appears / disappears.

2004-06-17  Sven Neumann  <sven@gimp.org>

 * autogen.sh: check for xsltproc and mention that the intltool
 version mismatch is harmless.

2004-06-17  Pedro Gimeno  <pggimeno@wanadoo.es>

 * tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation.
 Addresses bug #144267.

 * app/pdb/paths_cmds.c
 * libgimp/gimppaths_pdb.c: regenerated.

2004-06-17  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
 property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name"
 property because it's the hardware-determined name of this
 controller instance.

 * app/widgets/gimpcontrollerwheel.c
 * modules/controller_linux_input.c: set the name.

 * libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.

 * app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
 instead.  Don't dispatch events if the controller is
 disabled. Made everything work (not crash) with info->mapping
 being NULL.

 * etc/controllerrc: updated again with the changed format.

 * app/widgets/gimpcontrollers.[ch]: added
 gimp_controllers_get_list() which returns the container of
 controllers.

 * app/widgets/gimphelp-ids.h
 * app/gui/preferences-dialog.c: added controller configuration
 (can't change anything yet, just view the current settings).
 Resurrected the "Input Devices" page and removed the "Session"
 page by moving its widgets to other pages. Pack the various
 "Save now"/"Clear now" buttons vertically, not horizontally.
 Fixes bug #139069.

 * themes/Default/images/preferences/Makefile.am
 * themes/Default/images/preferences/controllers.png
 * themes/Default/images/preferences/theme.png: new icons for new
 prefs pages. Someone needs to make them nice...

2004-06-17  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar
 visible by default, hide it if options->show_menubar is FALSE.
 Fixes bug #143243.

2004-06-17  Sven Neumann  <sven@gimp.org>

 * configure.in: bumped version to 2.1.1. Allow to disable the
 build of the linux_input controller module.

2004-06-17  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/core/gimpdrawable-transform.c
 (gimp_drawable_transform_tiles_affine): Make transforms (most
 notably perspective transforms) conform exactly to specified
 edges. Includes a patch by David Gowers. Fixes bug #144352.

2004-06-16  Manish Singh  <yosh@gimp.org>

 * modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP}
 usage in #ifdefs, since pre-2.6 kernels do not have them.

 * modules/controller_linux_input.c (linux_input_read_event): n_bytes
 should be a gsize.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * app/actions/context-actions.c
 * app/actions/context-commands.[ch]: added actions & callback
 to select the first/last/prev/next tool.

2004-06-16  Simon Budig  <simon@gimp.org>

 * modules/controller_linux_input.c: removed BTN_MISC,
 since it is the same as BTN_0 in the input.h header file.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
 (gimp_controller_get_event_blurb): always return a non-NULL
 string (return "<invalid event id>" as fallback).

 * modules/controller_linux_input.c: reenabled button event
 dispatching.

 * app/widgets/gimpcontrollerinfo.c: fixed debugging output.

2004-06-16  Simon Budig  <simon@gimp.org>

 * modules/controller_linux_input.c: break out of the
 loop after we handled the first matching rel_event.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.[ch]: added #define
 GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.

 * modules/controller_linux_input.c: made "device-name"
 serializable.

 * app/config/gimpconfig-params.h: added macro
 GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
 by custom (de)serialize_property() implementations.

 * app/config/gimpconfig-deserialize.c
 * app/config/gimpconfig-serialize.c: made object (de)serialization
 work for object properties which are *not* GIMP_PARAM_AGGREGATE.
 Write/parse the exact type of the object to create to enable this.

 * app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.

 * app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
 and add "controller" and "mapping" properties. Add "event-mapped"
 signal which carries the action_name.

 * app/widgets/gimpcontrollers.c: removed all deserialization code
 and simply (de)serialize the controller container. Install a
 container handler for "event-mapped" and do the action_name ->
 action mapping in the callback.

 * etc/controllerrc: regenerated with new syntax. Delete your old one!

2004-06-16  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcontrollerwheel.c
 (gimp_controller_wheel_get_event_name): don't use gettext() here.

 * modules/controller_linux_input.c: added more button events, set
 the device name, some cleanup.

2004-06-16  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/plugin-defs.pl: changed dependencies for blur.

 * plug-ins/common/Makefile.am: regenerated.

 * plug-ins/common/blur.c: no need to include libgimpui.h any longer.

2004-06-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>

 * plug-ins/common/blur.c: removed randomize and repeat options;
 made to run without popping a dialog.  (bug #142318)

2004-06-16  Simon Budig  <simon@gimp.org>

 * modules/controller_linux_input.c: enable dial-events for
 e.g. the powermate. Fixed typo.

2004-06-16  Sven Neumann  <sven@gimp.org>

 * menus/image-menu.xml.in: added missing menu entries (bug #144449).

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.[ch]: added
 GimpController::get_event_blurb() which returns the strings that
 were returned by get_event_name(). The latter returns
 untranslatable event identifiers now.

 * app/widgets/gimpcontrollerwheel.c
 * modules/controller_linux_input.c: changed accordingly.

 * app/widgets/gimpcontrollerinfo.c
 * app/widgets/gimpcontrollers.c: changed the event mapping from
 event-id -> action-name to event-name -> action-name.

 * etc/controllerrc: changed accordingly (finally readable now).

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcontrollerinfo.[ch]: made an object out of
 the GimpControllerInfo struct.

 * app/widgets/gimpcontrollers.c: changed accordingly.

2004-06-16  Jakub Steiner <jimmac@ximian.com>

 * etc/controllerrc: fix typo

2004-06-16  Sven Neumann  <sven@gimp.org>

 * modules/controller_linux_input.c
 * etc/controllerrc: preliminary wheel event support.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollers.c: better debugging output.

2004-06-16  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcontrollers.c: bug fix.

 * configure.in: check for linux/input.h.

 * modules/Makefile.am
 * modules/controller_linux_input.c: added a prototype controller
 module using the linux input event interface.

 * etc/controllerrc: added example config for linux input device.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollers.c: load the controller's
 properties from the controllerrc file.

 * etc/controllerrc: set the wheel's properties.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * etc/controllerrc: use the 10% actions for opacity.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcontrollers.c: ref the actions when putting
 them in the mapping table.

 * app/actions/context-actions.c: added actions to change the
 opacity in 10% steps.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
 Dispatch events only if the controller is enabled.

 * app/widgets/gimpcontrollerwheel.c: added controller events for
 all possible modifier combinations.

 * etc/Makefile.am
 * etc/controllerrc: default controllerrc which maps all unused
 wheel+modifier combinations to more-or-less usefull stuff.

2004-06-16  Michael Natterer  <mitch@gimp.org>

 Started to fix bug #106920 in a more genreral way:

 * libgimpwidgets/Makefile.am
 * libgimpwidgets/gimpwidgetstypes.h
 * libgimpwidgets/gimpwidgetsmarshal.list
 * libgimpwidgets/gimpcontroller.[ch]: new abstract base class
 which provides an API for pluggable input controller modules
 (mouse wheel, usb/midi stuff etc.).

 * app/widgets/Makefile.am
 * app/widgets/widgets-types.h
 * app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
 which maps wheel mouse scroll events to controller events.

 * app/widgets/gimpcontrollers.[ch]: manager for controllers.
 reads $(gimpdir)/controllerrc and keeps a mapping of controller
 events to GtkActions.

 * app/gui/gui.c: initialize and shut down the controller stuff.

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_canvas_tool_events): if a wheel controller
 exists, dispatch GdkEventScroll to it first and return if it was
 handled.

2004-06-15  Sven Neumann  <sven@gimp.org>

 * tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API
 gimp_text() and gimp_text_get_extents().

 * app/pdb/text_tool_cmds.c
 * libgimp/gimptexttool_pdb.[ch]: regenerated.

2004-06-15  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/pdbgen.pl
 * tools/pdbgen/lib.pl: some simplistic code to add a $deprecated
 flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED
 guards in lib headers.

2004-06-15  Michael Natterer  <mitch@gimp.org>

 * app/actions/Makefile.am
 * app/actions/context-actions.[ch]
 * app/actions/context-commands.[ch]: added new action group to
 modify all GimpContext properties. So far there are actions to
 cycle through the lists of brushes, patterns etc., to change the
 opacity, to swap and default colors and to edit generated brushes.

 * app/actions/actions.c: register the new "context" action group.

 * app/actions/tools-actions.c
 * app/actions/tools-commands.[ch]: removed "tools-default-colors"
 and "tools-swap-colors" actions and callbacks because they are
 in the "context" action group now.

 * app/menus/menus.c: add the "context" group to the <Image> and
 <Dock> UI managers.

 * menus/image-menu.xml.in: changed accordingly. Added a temporary
 "Context" menu to test and debug the new actions.

2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimpcroptool.c (crop_selection_callback): Force
 aspect ratio to match selection when 'From Selection' is clicked.
 Fixes bug #144361. Also converted tabs to spaces.

2004-06-15  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/mng.c (respin_cmap): applied the fix for empty
 colormaps (bug #143009) here as well.

2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/core/gimpdrawable-transform.c
 (gimp_drawable_transform_tiles_affine): Don't round texture
 coordinates when not using interpolation. Fixes bug #144352 for
 the nearest neighbor case only.

2004-06-14  Sven Neumann  <sven@gimp.org>

 * app/paint/gimpinkoptions.c: replaced some arbitrary values with
 larger but still arbitrary values (default and limit for ink size).

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
 POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
 "gboolean traces_on_window" from GimpPaintCoreClass.

 * app/paint/gimpclone.[ch]
 * app/paint/gimpink.c
 * app/tools/gimpclonetool.c: changed accordingly.

 * app/tools/gimppainttool.c: ditto. Show the brush outline
 while painting. Fixes bug #118348.

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
 instead of GIMP_IS_DISPLAY(draw_tool->gdisp).

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
 do the workaround for "" accelerators only if the GTK+ version
 is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.

2004-06-14  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdrawable-transform.c: declared
 gimp_drawable_transform_cubic() as inline function. Makes
 sample_cubic() run about 10% faster and causes a 7% speedup on
 cubic transformations.

 * app/paint-funcs/paint-funcs.c (border_region): avoid an
 unnecessary memory allocation.

2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformtool.c: Disable preview in corrective
 mode, and notify preview when switching transform type and
 direction.

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/paint/gimppaintcore.[ch]: added new virtual function
 GimpPaintCore::post_paint() and call it after calling
 GimpPaintCore::paint().

 * app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
 to brush_core->main_brush and reset brush_core->brush
 to brush_core->main_brush in GimpPaintCore::post_paint().

 * app/paint/gimpbrushcore.c
 * app/paint/gimppaintcore-stroke.c
 * app/tools/gimppainttool.c: removed all code which restores
 the brush_core's old brush after painting since post_paint()
 does this automatically now.

 * app/paint/gimpclone.[ch]: moved static variables to the
 GimpClone struct.

2004-06-14  Sven Neumann  <sven@gimp.org>

 * app/paint-funcs/paint-funcs-generic.h (color_pixels): some code
 cleanup I did while attempting to optimize this code further.

2004-06-14  Henrik Brix Andersen  <brix@gimp.org>

 * app/plug-in/plug-in-run.c: let extensions run synchronously when
 called via PDB. Fixes bug #140112.

2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformtool.c: Preview is now only used for
 layer transformations.

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/tools/gimpperspectivetool.c
 * app/tools/gimprotatetool.c
 * app/tools/gimpscaletool.c
 * app/tools/gimpsheartool.c: removed calls to
 gimp_transform_tool_expose_preview() from all
 GimpTransformTool::motion() implementations...

 * app/tools/gimptransformtool.c: ...and call it after calling
 tr_tool_class->preview().

2004-06-14  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.[ch]: remember the last used
 GimpCursorFormat so changing the format in prefs applies
 instantly, and not after the next tool change.

 * app/display/gimpdisplayshell-cursor.[ch]
 * app/tools/gimptool.[ch]
 * app/tools/gimptoolcontrol.[ch]
 * app/tools/gimpclonetool.c
 * app/tools/gimpcolortool.c
 * app/tools/gimpcroptool.c
 * app/tools/gimpcurvestool.c
 * app/tools/gimpiscissorstool.c
 * app/tools/gimpmeasuretool.c
 * app/tools/gimpmovetool.c
 * app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g

2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
 wasn't being turned off before performing a transformation. Also
 converted tabs to spaces.

2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: Transformation previews now
 use the selection mask if it is present.

2004-06-13  Manish Singh  <yosh@gimp.org>

 * configure.in: Make sure PangoFT2 is using a recent enough fontconfig
 since many people have broken and confused setups.

2004-06-13  Manish Singh  <yosh@gimp.org>

 * tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated
 output doesn't warn about uninitialize variable use, and whitespace
 cosmetic cleanups.

 * app/pdb/gradient_edit_cmds.c: regenerated.

2004-06-13  Manish Singh  <yosh@gimp.org>

 * app/base/cpu-accel.c: Reorged, to address bug #142907 and
 bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel()
 keys on that. Both PPC and X86 implementations check for __GNUC__.
 X86 stuff is only used with USE_MMX is defined. The SSE OS check
 is now checked in arch_accel(), not cpu_accel(). Finally, the
 arch x86_64 checks now are EM64T aware (which didn't matter in
 practice).

2004-06-13  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds()
 for texture coordinates instead of the drawable's width and height.

2004-06-13  Sven Neumann  <sven@gimp.org>

 * app/paint-funcs/paint-funcs.c (shapeburst_region): don't call
 tile_ewidth() three times from the inner loop.

 * app/base/tile-manager.c (tile_manager_get): don't call
 tile_size() twice on the same tile.

 * app/base/tile-private.h: added tile_size_inline(), an inline
 version of the tile_size() function.

 * app/base/tile-cache.c
 * app/base/tile-manager.c
 * app/base/tile-swap.c
 * app/base/tile.c: use tile_size_inline() from inside the tile
 subsystem.

2004-06-13  Simon Budig  <simon@gimp.org>

 * app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
 Shouldn't change anything.

2004-06-13  Jakub Steiner <jimmac@ximian.com>

 * cursors/tool-zoom.png:
 * cursors/cursor-zoom.png: minor fsckup

2004-06-13  Jakub Steiner <jimmac@ximian.com>

 * cursors/gimp-tool-cursors.xcf
 * cursors/tool-burn.png: the burn tool doesn't really have an
   inverted handle

2004-06-13  Sven Neumann  <sven@gimp.org>

 * app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added
 progress callback.

 * app/core/gimpdrawable-blend.c: show a progress while calculating
 the Shapeburst. Not perfect but better than not showing any
 progress at all.

2004-06-13  Michael Natterer  <mitch@gimp.org>

 * app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
 which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
 work around broken X servers.

 * app/config/gimpguiconfig.[ch]
 * app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.

 * app/gui/preferences-dialog.c: added a GUI for the new option.

 * app/widgets/gimpcursor.[ch]: added cursor_format parameter
 to gimp_cursor_new() and _set().

 * app/display/gimpdisplayshell-cursor.c
 * app/tools/gimpcurvestool.c
 * app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.

2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/core/gimpdrawable-blend.c: added missing semicolon.

2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
 caused perfect-but-slow pointer tracking to be used in tools that
 don't request exact mode.

 * app/display/Makefile.am:
 * app/display/gimpdisplayshell-appearance.[ch]:
 * app/display/gimpdisplayshell-callbacks.c:
 * app/display/gimpdisplayshell.[ch]:
 * app/display/gimpdisplayshell-preview.[ch]: added
 * app/tools/gimpperspectivetool.c:
 * app/tools/gimprotatetool.c:
 * app/tools/gimpscaletool.c:
 * app/tools/gimpsheartool.c:
 * app/tools/gimptransformoptions.[ch]:
 * app/tools/gimptransformtool.[ch]: Implemented live transformation
 previews, available through tool options. Fixes bug #108172.

2004-06-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdrawable-blend.c (gradient_render_pixel): inline
 the repeat functions.

 * app/core/gimpgradient.c: inline the curve functions.

2004-06-13  Jakub Steiner <jimmac@ximian.com>

 * cursors/gimp-tool-cursors.xcf
 * cursors/tool-zoom.png: make more transparent

2004-06-13  Jakub Steiner <jimmac@ximian.com>

 * cursors/gimp-tool-cursors.xcf
 * cursors/tool-blur.png
 * cursors/tool-bucket-fill.png
 * cursors/tool-dodge.png
 * cursors/tool-eraser.png
 * cursors/tool-hand.png: fix a few problems hidden by low opacity

2004-06-13  Jakub Steiner <jimmac@ximian.com>

 * cursor/*png: updated the cursors

2004-06-13  Michael Natterer  <mitch@gimp.org>

 * cursors/gimp-tool-cursors.xcf: added nice new antialiased
 cursor layers made by Jimmac.

2004-06-13  Sven Neumann  <sven@gimp.org>

 * app/core/gimppalette.c (gimp_palette_load): don't use the rather
 inefficient gimp_palette_add_entry() when loading a palette.

2004-06-13  Michael Natterer  <mitch@gimp.org>

 * app/core/gimpdata.[ch]: added "gint freeze_count" and
 gimp_data_freeze()/thaw() functions. Emit "dirty" only if
 freeze_count either is 0 or drops to 0.

 * app/core/gimpbrushgenerated.[ch]
 * app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
 was duplicated in these two subclasses and use the new
 GimpData API instead.

 * app/widgets/gimpbrusheditor.c
 * app/widgets/gimpgradienteditor.c: changed accordingly.

2004-06-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
 the first row onto itself.

2004-06-12  Simon Budig  <simon@gimp.org>

 * app/tools/gimptransformtool.c: Make Enter/Return apply the
 transformation, Backspace/Delete resets the transformation.

 * app/tools/gimpcroptool.c: Simplify the key_press callback.

2004-06-12  Simon Budig  <simon@gimp.org>

 * app/tools/gimpcroptool.c: Make the Enter/Return key do
 the crop action.

 * app/tools/gimpeditselectiontool.c
 * app/tools/gimpvectortool.c: Make the _key_press functions
 safe for non-arrow keys.

2004-06-12  Sven Neumann  <sven@gimp.org>

 * app/composite/gimp-composite.[ch]: just some cleanup.

2004-06-12  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell-callbacks.c
 (gimp_display_shell_events): ported some forgotten #if 0'ed
 GtkItemFactory stuff to GtkUIManager.

2004-06-12  Simon Budig  <simon@gimp.org>

 * app/tools/gimptool.[ch]: renamed the "arrow_key" member
 to "key_press", since it is now no longer about just the arrow
 keys.

 * app/tools/gimpcroptool.c
 * app/tools/gimpeditselectiontool.c
 * app/tools/gimpeditselectiontool.h
 * app/tools/gimpmovetool.c
 * app/tools/gimppainttool.c
 * app/tools/gimpselectiontool.c
 * app/tools/gimptexttool.c
 * app/tools/gimpvectortool.c
 * app/tools/tool_manager.c: Changed accordingly.

2004-06-12  Michael Natterer  <mitch@gimp.org>

 * app/display/gimpdisplayshell.c (gimp_display_shell_init): add
 the file DND destination before all others so the DND code will
 implicitly use its destination properties. Works around Konqueror
 offering only file MOVE, not COPY and fixes bug #144168.

2004-06-12  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/sample_colorize.c: reindented, some minor cleanup.

2004-06-12  Simon Budig  <simon@gimp.org>

 * app/tools/tool_manager.[ch]: renamed
 tool_manager_arrow_key_active to tool_manager_key_press_active.

 * app/display/gimpdisplayshell-callbacks.c: Also dispatch
 GDK_Return/KP_Enter/BackSpace/Delete to the tools, the
 "arrow_key" member of GimpTool probably should be renamed.

 * app/tools/gimpvectortool.c: Use Enter/Return to convert the
 current path to a selection, use Backspace/Delete to delete the
 currently active anchors in a path.

 Implemented on Jimmacs request - thanks to him and Iva for being
 a great host  :)

2004-06-12  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
 set the initially selected channel on the histogram combobox.
 Fixes bug #144225.

2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
 variables to "pressure-hardness".

 * app/paint/gimpairbrush.c:
 * app/tools/gimppaintoptions-gui.c: changed accordingly.

2004-06-10  Michael Natterer  <mitch@gimp.org>

 * libgimpwidgets/gimpcolorarea.c: replaced destroy() by
 finalize(), converted tabs to spaces, cleanup.

2004-06-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
 filename label if it's too long instead of cutting it off.

2004-06-10  Michael Natterer  <mitch@gimp.org>

 * app/widgets/widgets-enums.h (enum GimpCursorModifier):
 s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.

 * app/widgets/gimpcursor.c: changed accordingly. Renamed struct
 GimpBitmapCursor to GimpCursor. More cleanup.

2004-06-10  Michael Natterer  <mitch@gimp.org>

 * app/actions/image-actions.c
 * app/actions/image-commands.[ch]
 * app/actions/layers-actions.c
 * app/actions/layers-commands.[ch]: made the
 "image-convert-rgb/grayscale/indexed" and the
 "layers-mask-apply/delete" actions GimpEnumActions and merged
 their callbacks.

2004-06-10  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/gui/preferences-dialog.c: restored the 'Show Paint Tool
 Cursor' option that was removed during clean-up.

2004-06-10  Philip Lafleur  <plafleur@cvs.gnome.org>

 * app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask):
 avoided some redundant calculations.

2004-06-10  Sven Neumann  <sven@gimp.org>

 * app/gui/user-install-dialog.c: removed the monitor calibration
 from the user installation process. It's not a vital setting and
 can be done from the Preferences dialog later.

 * app/gui/resolution-calibrate-dialog.[ch]: simplified the
 resolution calibration dialog by removing the hacks that were
 needed for drawing it in the user-installation style.

 * app/gui/preferences-dialog.c: changed accordingly. Also removed
 the separator from the Display page.

2004-06-10  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptemplateeditor.[ch]: added an API to
 expand/collapse the "Advanced Options" frame.

 * app/gui/preferences-dialog.c
 * app/widgets/gimphelp-ids.h: applied a patch done by William
 Skaggs that cleans up and reorganizes the Preferences dialog
 (bug #144060).

2004-06-09  Simon Budig  <simon@gimp.org>

 * app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to
 gimp_coords_length_squared.

 * app/vectors/gimpbezierstroke.c: Changed accordingly

2004-06-09  Sven Neumann  <sven@gimp.org>

 * app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to
 request GIMP_MOTION_MODE_EXACT here since the parent class does
 that already.

 * app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
 color picker feature for the ink tool.

2004-06-09  Sven Neumann  <sven@gimp.org>

 * menus/image-menu.xml.in: added "Selection Editor" to the
 Selection menu. Still hoping for the great menu reorganization
 though...

 * app/actions/select-actions.c (select_actions_update): "Save to
 Channel" makes sense without a selection also, so don't set it
 insensitive.

2004-06-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/glob.c: the glob(3) function is not available on
 Win32 and also isn't necessarily UTF-8 safe. Started to add an
 alternative implementation. Right now there's just some code taken
 from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in
 does nothing useful. I will add some stripped-down glob code based
 on the code in glibc later.

2004-06-07  Michael Natterer  <mitch@gimp.org>

 * app/core/gimplayer.c (gimp_layer_set_tiles): don't set
 layer->mask's offsets. It is wrong because GimpDrawable::set_tiles()
 is a lowlevel function which is used by stuff like scale and
 resize which keep the mask in sync explicitely and don't expect it
 to be moved in the middle of chaining up. Fixes bug #143860.

2004-06-07  Michael Natterer  <mitch@gimp.org>

 * app/actions/view-actions.c
 * app/actions/view-commands.[ch]: added separate callback for
 "view-zoom-other" and connect GtkAction::activate manually so
 "Other..." can be selected even if it's the active item in the
 zoom radio group. Fixes bug #143850.

2004-06-07  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tileit.c (tileit_dialog): fixed a typo.

2004-06-07  Sven Neumann  <sven@gimp.org>

 * app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus
 by the translated menu path stripped from underscores.

2004-06-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug
 I introduced yesterday.

2004-06-06  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/gauss.c (query): register the menu entry the new
 way and install a mnemonic for Gaussian Blur.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/curve_bend.c: applied a patch from Henrik Brix
 Andersen that tells the user that Curve Bend cannot operate on
 layers with masks instead of silently applying the mask
 (bug #134748).

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/plugin-defs.pl
 * plug-ins/common/Makefile.am
 * plug-ins/common/gauss_iir.c
 * plug-ins/common/gauss_rle.c: removed the two gaussian blur
 plug-ins...

 * plug-ins/common/gauss.c: and added a merged version done by
 William Skaggs. Fixes bug #134088.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that
 makes the plug-in handle images with more than 4 channels. At the
 moment the extra information is discarded (bug #143673).

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/unsharp.c: applied a modified patch from Geert
 Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes
 bug #140974.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * app/paint/gimppaintcore.c
 * app/paint-funcs/paint-funcs-generic.h
 * app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip
 Lafleur that changes the way that paint is applied during a paint
 stroke. Fixes bug #124225.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/Makefile.am
 * plug-ins/common/plugin-defs.pl
 * plug-ins/common/glob.c: added a simple glob plug-in based on
 some old code by George Hartz. This plug-in is very useful when
 you need to do batch processing, especially from Script-Fu.
 Fixes bug #143661.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimpgradienteditor.c: applied a patch from David
 Gowers that makes the gradient editor display the perceptual
 intensity of the color under the cursor (bug #135037).

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/snoise.c: applied a modifed patch from Yeti that
 adds a preview to the Solid Noise plug-in (bug #142587).

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/common/tiff.c: save the proper value for type of alpha
 channel. Fixes bug #143522; patch by Philip Lafleur.

2004-06-05  Manish Singh  <yosh@gimp.org>

 * app/gui/preferences-dialog.c (prefs_dialog_new): update call
 to prefs_spin_button_add for num-processors too.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * plug-ins/script-fu/script-fu-scripts.c (script_fu_interface):
 left align toggle buttons.

2004-06-05  Sven Neumann  <sven@gimp.org>

 * app/text/gimptextlayer-transform.[ch]: updated the (still unused)
 text transformation code.

 * app/text/gimptext-bitmap.c: removed a redundant transformation.

2004-06-05  Michael Natterer  <mitch@gimp.org>

 * cursors/Makefile.am
 * cursors/cursor-none.png
 * cursors/xbm/cursor-none.xbm: new empty cursor images.

 * app/config/gimpdisplayconfig.[ch]
 * app/config/gimprc-blurbs.h
 * app/widgets/widgets-enums.h
 * app/widgets/gimpcursor.c
 * app/display/gimpdisplayshell-cursor.c
 * app/tools/gimppainttool.[ch]
 * app/tools/gimpinktool.c
 * app/gui/preferences-dialog.c: applied patches from Philip
 Lafleur which implement hiding the cursor completely for paint
 tools. Changed the name of the config option from
 "hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
 to TRUE because this needs the brush outline being visible while
 painting to be really usable. Fixes bug #132163.

 * app/widgets/widgets-enums.h: renamed all GimpCursorType and
 GimpToolCursorType enum values to GIMP_CURSOR_* and
 GIMP_TOOL_CURSOR_*.

 * app/widgets/gimpcursor.c
 * app/display/gimpdisplayshell-callbacks.c
 * app/display/gimpdisplayshell-cursor.c
 * app/tools/gimp*tool.c; changed accordingly.

2004-06-04  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcursor.c: changed create_cursor_foo() utility
 functions to get_cursor_foo() and use them as accessors instead of
 using cursor->member. Use gdk_pixbuf_copy() instead of compositing
 the initial image onto an empty pixbuf.

2004-06-04  Sven Neumann  <sven@gimp.org>

 * app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
 focus on the text area.

2004-06-04  Sven Neumann  <sven@gimp.org>

 * app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
 move a text layer using the cursor keys.

2004-06-04  Michael Natterer  <mitch@gimp.org>

 * cursors/*.xbm: removed...

 * cursors/xbm/*.xbm: ...and added here instead. Renamed them
 all to match the PNG file names.

 * cursors/Makefile.am: changed accordingly.

 * app/widget/gimpcursor.c: ditto. Merged the two cursor creating
 functions again because they duplicated too much code.

2004-06-04  Sven Neumann  <sven@gimp.org>

 * app/menus/plug-in-menus.c (plug_in_menus_setup): populate the
 tree with collation keys and use strcmp() instead of
 g_utf8_collate() as the tree's sort function.

2004-06-04  Sven Neumann  <sven@gimp.org>

 * app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE):
 applied a patch by Philip Lafleur that changes the default to
 FALSE. Fixes bug #143626.

2004-06-03  Michael Natterer  <mitch@gimpmp.org>

 * app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use
 gtk_widget_size_request() instead of _get_child_requisition()
 because we need to know the size of the toolbox' areas
 even if they are invisible. Fixes SIGFPE spotted by Jimmac.

2004-06-03  Michael Natterer  <mitch@gimp.org>

 * app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor
 and cursor_modifier components slightly transparent.

 * cursors/cursor-mouse.png: was the wrong image.

2004-06-03  Michael Natterer  <mitch@gimp.org>

 * cursors/Makefile.am
 * cursors/*.png: added PNG version of all cursors.

 * cursors/gimp-tool-cursors.xcf: reordered and renamed all layers
 to match the new PNG filenames.

 * app/widgets/gimpcursor.[ch]: create cursors with alpha and color
 if the GdkDisplay supports it. Fall back to the old stuff
 otherwise.

2004-06-03  Sven Neumann  <sven@gimp.org>

 * app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is
 set, use that as the pattern name.

2004-06-03  Sven Neumann  <sven@gimp.org>

 * app/core/gimpdatafactory.c (gimp_data_factory_load_data):
 removed commented-out message.

 * app/core/gimppattern.[ch]: fixed handling of errors and PNG
 comments in new pattern loader. Renamed functions for consistency
 with other data loaders.

 * app/core/gimp.c: changed accordingly.

2004-06-03  Dave Neary  <bolsh@gimp.org>

 * app/core/gimp.c:
 * app/core/gimpdatafactory.c:
 * app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
 so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
 xpm and tiff can be used for patterns.

2004-06-03  Michael Natterer  <mitch@gimp.org>

 * app/actions/vectors-actions.c: added alternative actions
 "vectors-selection-from-vectors" and
--> --------------------

--> maximum size reached

--> --------------------